At Genmab, we are dedicated to building extra[not]ordinary futures, together, by developing antibody products and groundbreaking, knock-your-socks-off KYSO antibody medicines that change lives and the future of cancer treatment and serious diseases. We strive to create, champion and maintain a global workplace where individuals' unique contributions are valued and drive innovative solutions to meet the needs of our patients, care partners, families and employees.
Our people are compassionate, candid, and purposeful, and our business is innovative and rooted in science. We believe that being proudly authentic and determined to be our best is essential to fulfilling our purpose. Yes, our work is incredibly serious and impactful, but we have big ambitions, bring a ton of care to pursuing them, and have a lot of fun while doing so.
Does this inspire you and feel like a fit? Then we would love to have you join us!
The Senior Oncology Account Manager (SOAM) for the Dallas territory builds and maintains strong professional relationships with key customers and stakeholders across Dallas/Ft. Worth including private practices, medical group practices, hospitals/academic medical centers, and ancillary staff involved in the care of cancer patients. Therapeutic area: Gynecologic Oncology. Territory: Dallas, Ft. Worth, Amarillo, Bedford, Richardson, Rowlett, and others.
As a clinical and business leader, the SOAM represents the values of Genmab by providing approved disease and product information, resources, and support to key decision-makers and stakeholders within the assigned geography.
Responsibilities
Effectively support Genmab's Solid Tumor Oncology portfolio in the U.S. marketplace, focusing on customers within the Dallas territory.
Achieve or exceed assigned sales goals by effectively positioning Genmab's products for appropriate patients.
Demonstrate effective time management by prioritizing engagements that drive brand value and patient impact.
Develop and implement a robust territory business plan tailored to the needs of the Dallas oncology landscape.
Flex seamlessly between virtual and in-person engagements, aligning with customer communication preferences.
Analyze key market data points and convert insights into actionable business plans.
Build and sustain long-term, value-based relationships with customers across all assigned accounts.
Represent Genmab's brands in a professional, compliant, and ethical manner.
Maintain a deep understanding of disease states, Genmab's brands, and competitor products to effectively communicate value across all channels (digital and live).
Demonstrate proficiency in navigating the reimbursement environment for injectable oncology therapies.
Exhibit strong territory management and superior selling competencies, with a focus on gaining meaningful in-person access to customers.
Contribute to team effectiveness by sharing insights, experiences, and best practices.
Manage territory resources and budget effectively.
Comply with all laws, regulations, and company policies governing Genmab U.S. operations.
Requirements
Bachelor's degree (BS/BA) required.
Five or more years of pharmaceutical sales experience; minimum three years of demonstrated success in oncology sales.
Gynecologic Oncology, Antibody-Drug Conjugate (ADC) therapy, rare disease, and solid tumor experience preferred.
Oncology product launch experience preferred.
Proven account management capabilities, advanced selling skills, and a consistent record of exceeding goals.
Strong business analytics skills to understand and act on key market drivers.
Demonstrated ability to build and maintain professional relationships with oncologists, office staff, and key influencers.
Proven success working cross-functionally in matrix teams.
Self-motivated, with a record of continuous learning and development.
Proficiency in MS Word, Excel, PowerPoint, Outlook, Teams, and Veeva Engage.
Flexible, detail-oriented, and adept at managing multiple priorities.
Excellent communication, organizational, and presentation skills.
Commitment to operating within ethical and regulatory standards.
Must reside within the Dallas territory and be available for regional travel as required.
For US based candidates, the proposed salary band for this position is as follows:
$160,000.00---$240,000.00
The actual salary offer will carefully consider a wide range of factors, including your skills, qualifications, experience, and location. Also, certain positions are eligible for additional forms of compensation, such as discretionary bonuses and long-term incentives.
When you join Genmab, you're joining a culture that supports your physical, financial, social, and emotional wellness. Within the first year, regular full-time U.S. employees are eligible for:
401(k) Plan: 100% match on the first 6% of contributions
Health Benefits: Two medical plan options (including HDHP with HSA), dental, and vision insurance
Voluntary Plans: Critical illness, accident, and hospital indemnity insurance
Time Off: Paid vacation, sick leave, holidays, and 12 weeks of discretionary paid parental leave
Support Resources: Access to child and adult backup care, family support programs, financial wellness tools, and emotional well-being support
Additional Perks: Commuter benefits, tuition reimbursement, and a Lifestyle Spending Account for wellness and personal expenses
About You
You are genuinely passionate about our purpose
You bring precision and excellence to all that you do
You believe in our rooted-in-science approach to problem-solving
You are a generous collaborator who can work in teams with a broad spectrum of backgrounds
You take pride in enabling the best work of others on the team
You can grapple with the unknown and be innovative
You have experience working in a fast-growing, dynamic company (or a strong desire to)
You work hard and are not afraid to have a little fun while you do so!
Locations
Genmab maximizes the efficiency of an agile working environment, when possible, for the betterment of employee work-life balance. Our offices are crafted as open, community-based spaces that work to connect employees while being immersed in our powerful laboratories. Whether you're in one of our office spaces or working remotely, we thrive on connecting with each other to innovate.
About Genmab
Genmab is an international biotechnology company with a core purpose to improve the lives of patients through innovative and differentiated antibody therapeutics. For 25 years, its hard-working, innovative and collaborative team has invented next-generation antibody technology platforms and harnessed translational, quantitative and data sciences, resulting in a proprietary pipeline including bispecific T-cell engagers, antibody-drug conjugates, next-generation immune checkpoint modulators and effector function-enhanced antibodies. By 2030, Genmab's vision is to transform the lives of people with cancer and other serious diseases with Knock-Your-Socks-Off (KYSO ) antibody medicines.
Established in 1999, Genmab is headquartered in Copenhagen, Denmark with international presence across North America, Europe and Asia Pacific. For more information, please visit Genmab.com and follow us on LinkedIn and X.
Genmab is committed to protecting your personal data and privacy. Please see our privacy policy for handling your data in connection with your application on our website Job Applicant Privacy Notice (genmab.com).
Please note that if you are applying for a position in the Netherlands, Genmab's policy for all permanently budgeted hires in NL is initially to offer a fixed-term employment contract for a year, if the employee performs well and if the business conditions do not change, renewal for an indefinite term may be considered after the fixed-term employment contract.
$160k-240k yearly 2d ago
Looking for a job?
Let Zippia find it for you.
Account Executive
Hirelifescience.com
Account executive job in Piscataway, NJ
HireLifeScience.com is a career resource and networking tool for finding Life Science jobs in the Pharmaceutical, Biotechnology and Medical Device industries.
Our parent company, Aequor is a Global consulting and staffing services company providing Contingent Workforce (CW) Staffing services, for over the past 26 years, to the leading Life Science and Healthcare companies.
We are currently hiring for a Sales AccountExecutive role. This position offers a base salary, plus commission.
Core Duties and Responsibilities:
-Generate profitable sales revenue while meeting or exceeding sales quotas by selling online recruitment advertising, career fair registrations and traditional staffing placement services.
-Build a book of business consisting of national clients in the life science industries, pharma, biotech and medical device
-Identify, qualify, call on and establish long-term business relationships with Life Science employers.
-Present the value of the HireLifeScience.com to prospects.
-Work collaboratively in a consultative role with talent acquisition decision makers to identify the best HireLifeScience.com options for their recruitment efforts and plan.
-Continually build a strong sales pipeline of well qualified revenue opportunities.
-Farming existing clients accounts to identify new opportunities and maximize staffing sales
-Utilize company CRM tool to track all sales activities and communications.
-Manage and maintain sales reports, pipelines and forecasts.
Position Requirements:
-Min. Associate's degree, preferably in Business, Marketing or related field preferred.
-Four (4) plus years of sales experience in Advertising Sales and/or talent acquisition.
-Ability to prioritize and plans work activities; excellent time management skills.
$54k-88k yearly est. 4d ago
Residential Sales Consultant
Pella Corporation 4.7
Account executive job in Ocean, NJ
Pella Corporation is seeking a motivated Residential Sales Consultant to support our territory across Ocean, Monmouth, Middlesex, Somerset, and Union Counties. We're looking for a confident, outgoing professional who thrives in a fast‑paced environment, enjoys building relationships, and is driven to excel. If you are self-disciplined, competitive, and passionate about helping homeowners improve their spaces, this is the role for you.
As a Residential Sales Consultant, you will sell Pella windows and doors directly to homeowners seeking replacement solutions. Using in‑home consultations and a structured sales process, you'll identify customer needs and align them with the best Pella products. You will work toward first‑time close opportunities and provide strong follow‑up to capture remaining sales. Pella provides qualified appointments with 24-hour notice. Sales consultants are supported with training to generate additional leads through networking, referrals, and proactive outreach to maximize your unlimited earning potential. This role requires periodic attendance at meetings held at the Parsippany, NJ Pella office or Pella showrooms.
Pella Corporation offers the following:
• This position offers a base salary of $60,000 plus uncapped commission
• Standard IRS mileage reimbursement
• Hybrid work environment that includes your home office & appointments in the customer's home
• Full benefits package which includes medical, dental, and vision
• Health savings and flex spending accounts
• Company paid life insurance
• Company paid short/long term disability insurance
• 401k with company match
• 20 paid vacation days and paid holidays
• In-depth training program that includes virtual & hands on learning
• Quality engineered product solutions that are unmatched in the window and door industry
• Smartphone, tablet, laptop computer, and product samples provided
• Solid reputation of the Pella Brand
• Exciting, nationwide career growth opportunities
Responsibilities/Accountabilities:
Achieving individual sales and customer satisfaction goals and objectives.
Effectively presenting Pella solutions to customers by executing the Pella Retail Sales Process during the in-home consultation.
Striving to close the sale during all customer interactions.
Ensuring quotes and orders are accurate following company sales process.
Responding to customer concerns and engaging sales support resources to achieve first-time resolution on all customer problems/issues.
Be available for customer appointments during evenings and weekends, in addition to weekday hours.
Maintaining an exceptional level of expertise in products/services relating to Pella's customers, as well as staying abreast of the competitive landscape.
Conducting after-sales follow-up with customers and developing lead and referral generation.
Actively represent Pella at company sponsored events, invitations to discuss and/or present Pella products, and/or home shows.
Strong customer database systems tools capabilities leveraged to manage all customer interactions and proactively communicate to customers.
Skills/Knowledge
Able to quickly earn trust and credibility with customers
Provide superb customer service and generate referrals from one customer to others
Skilled at relating to a variety of customers- balances poise and integrity with a service mentality
Able to negotiate, build value and address objections towards closing a sale
Works collaboratively with Pella team members and customers
Able to grasp technical concepts related to general construction
Strong problem-solving skills
Energized by meeting and engaging new people, skilled networker
Tenacious, able to persevere through sales challenges and setbacks
Demonstrates a strong work ethic, flexible about hours, responsive to customer needs, and willing to be available
Seeks out internal experts and utilizes their knowledge
Adaptable to changing processes and priorities
Works well without close supervision but always keeps their manager informed.
Proficiency with Microsoft Office and smart devices, and ability to learn internal software programs and applications
Qualifications
To perform this job successfully, an individual must be able to perform each essential duty satisfactorily. Reasonable accommodations may be made to enable individuals with disabilities to perform the essential functions.
Education and/or Experience
Bachelor's degree (B. A.) from four-year college or university; or one to two years related experience and/or training, or equivalent combination of education and experience. Individual's motor vehicle record must also comply with company requirements. Must have the ability to manage multiple tasks in an environment of constant interruptions and be able to prioritize responsibilities.
Language and Communication Skills
Ability to read and analyze documents related to contracts and work documents. Ability to write reports and business correspondence. Ability to verbally present information and respond to questions from customers, managers, and the general public.
Professional Skills
Must present a clean and neat physical appearance and strictly abide by company dress code serving as a role model for other employees, customers and visitors.
Reasoning Abilities
Ability to solve practical and arithmetic problems and deal with a variety of concrete variables in situations where only limited standardization exists.
Physical Demands
While performing the duties of this job, the employee is regularly required to drive an automobile, stand; walk; sit; use hands to finger, handle, or feel; reach with hands and arms; and talk or hear. The employee is occasionally required to climb or balance; stoop, kneel, crouch, or crawl. The employee must regularly lift and/or move up to 10 pounds and frequently lift and/or move up to 25 pounds, and occasionally lift and/or move up to 50 pounds using proper lifting techniques. Specific vision abilities required by this job include close vision, distance vision, color vision, and ability to adjust focus. The noise level in the work environment varies between low to moderate in administrative offices and to moderate on constructions sites.
Travel
The vast majority of travel will be local. Must be able to drive to showrooms, job sites and customer/contractor locations and required company functions at various locations.
$60k yearly 2d ago
Sales Executive - Off Price
Fourth Floor 3.6
Account executive job in Edison, NJ
Our client, a home and apparel company is looking for a Sales Executive to work on their off-price accounts.
Responsibilities
Drive new business development within the off-price retail channel
Establish and maintain strong partnerships with buyers and key decision-makers
Uncover growth opportunities and design customized programs tailored to each retail partner
Collaborate closely with product development and sourcing teams to execute concepts from idea through production
Own sales strategy, pricing approach, and program delivery across the full lifecycle
Represent the company at trade shows, buyer appointments, and relevant industry events
Qualifications
Demonstrated success selling to off-price retailers such as TJX, Ross, and Burlington
Strong relationship-focused professional with an entrepreneurial, proactive sales mindset
Strategic builder capable of developing new business from the ground up
Self-directed, confident, and driven by results
Thrives in a fast-paced, ever-evolving business environment
$50k-78k yearly est. 3d ago
Key Account Executive (Sales Representative) - Northern Virginia
Labcorp 4.5
Account executive job in Woodbridge, NJ
Recognized by Forbes as one of America's Best Employers For Diversity 2024 and once again named to FORTUNE magazine's list of the World's Most Admired Companies, Labcorp is seeking to hire a Key AccountExecutive who will be the forward face of our company and engage existing and prospective clients alike at all levels.
This entry level role is a unique opportunity to join a leading global life sciences company and a team focused on advancement in patient health and powers clear, confident decisions through its diagnostics and drug development offerings, selling the benefits of Labcorp in outpatient healthcare offices.
As a Key AccountExecutive, you will be responsible for managing a large existing book of business while also introducing focus specialty products, analytical platforms and workflow efficiencies to our clients.
The territory for this position will cover the Northern Virginia area - Alexandria, Fairfax, Woodbridge and surrounding areas. It will require mostly day travel with little overnight travel. The ideal candidate will reside within the territory.
We are seeking a competitive and collaborative individual with a high degree of communication and business acumen skills who enjoys growing and working with a high-performing team across a wide variety of high-growth areas.
Job Duties/Responsibilities:
* Educate, instruct, and upsell all assigned and newly generated accounts in an assigned territory
* Act as a liaison between the client and the Labcorp operations team in relation to client needs
* Provide ongoing service and timely resolution to customer base
* Ensure customer retention by providing superior customer service
* Recommend solutions that are client focused
* Provide account management for client's day to day operations
* Collaborate with entire sales team to grow book of business
* Meet and exceed monthly retention and upsell goals
Requirements:
* Bachelor's degree is strongly preferred
* Previous sales experience or account management of 3+ years is preferred
* Experience in the healthcare industry is a plus
* Proven success managing a book of business
* Superior customer service skills with the ability to develop trust-based relationships
* Effective communication skills, both written and verbal
* Ability to deliver results in a fast paced, competitive market
* Excellent time management and organizational skills
* Proficient in Microsoft Office and Excel
* Valid driver's license and clean driving record
Benefits: Employees regularly scheduled to work 20 or more hours per week are eligible for comprehensive benefits including: Medical, Dental, Vision, Life, STD/LTD, 401(k), Paid Time Off (PTO) or Flexible Time Off (FTO), Tuition Reimbursement and Employee Stock Purchase Plan. Casual, PRN & Part Time employees regularly scheduled to work less than 20 hours are eligible to participate in the 401(k) Plan only. Employees who are regularly scheduled to work a 7 on/7 off schedule are eligible to receive all the foregoing benefits except PTO or FTO. For more detailed information, please click here.
Labcorp is proud to be an Equal Opportunity Employer:
Labcorp strives for inclusion and belonging in the workforce and does not tolerate harassment or discrimination of any kind. We make employment decisions based on the needs of our business and the qualifications and merit of the individual. Qualified applicants will receive consideration for employment without regard to race, religion, color, national origin, sex (including pregnancy, childbirth, or related medical conditions), family or parental status, marital, civil union or domestic partnership status, sexual orientation, gender identity, gender expression, personal appearance, age, veteran status, disability, genetic information, or any other legally protected characteristic. Additionally, all qualified applicants with arrest or conviction records will be considered for employment in accordance with applicable law.
We encourage all to apply
If you are an individual with a disability who needs assistance using our online tools to search and apply for jobs, or needs an accommodation, please visit our accessibility site or contact us at Labcorp Accessibility. For more information about how we collect and store your personal data, please see our Privacy Statement.
$120k-159k yearly est. Auto-Apply 8d ago
Account Executive - Large Enterprise Pipeline Activation
Lumen 3.4
Account executive job in Trenton, NJ
Lumen connects the world. We are igniting business growth by connecting people, data and applications - quickly, securely, and effortlessly. Together, we are building a culture and company from the people up - committed to teamwork, trust and transparency. People power progress.
We're looking for top-tier talent and offer the flexibility you need to thrive and deliver lasting impact. Join us as we digitally connect the world and shape the future.
**The Role**
The AccountExecutive LE Pipeline Activation plays a pivotal role in advancing Lumen's most strategic enterprise pursuits. This position partners with Large Enterprise Account Directors and cross functional teams to strengthen deal strategy, sharpen commercial positioning, and ensure pursuit readiness from first engagement through close.
AccountExecutives are embedded deal experts who bring commercial rigor, insight, and field credibility. They elevate deal quality by tightening execution, improving alignment, and ensuring Lumen shows up with precision and confidence in its most important opportunities.
The main objective of the role is to increase win rates, opportunity value, and deal quality across Large Enterprise by strengthening pursuit strategy, commercial discipline, and execution readiness.
**The Main Responsibilities**
Strategic Deal Support
+ Engage early in major pursuits to refine opportunity framing, validate value hypotheses, and confirm commercial soundness.
+ Work with Account Directors to align customer needs, solution design, and pricing strategy.
+ Drive clarity around deal strategy, stakeholder mapping, and key decision sequences.
Pursuit Enablement
+ Collaborate with Account Directors and EDGE leadership to ensure strategic pursuits move with focus and consistency.
+ Introduce structure and accountability into pursuit planning without assuming ownership of the deal.Provide visibility to leadership on progress, risks, and necessary actions.
Commercial Insight and Financial Discipline
+ Partner with Finance and Offer Management teams to analyze deal economics, margin integrity, and contract structure.
+ Identify commercial risks early and recommend changes that protect profitability and credibility.Help teams understand financial levers and decision tradeoffs.
Executive and Partner Engagement
+ Coordinate internal and external executive involvement in major pursuits.
+ Develop concise briefing materials, talking points, and sequencing plans that enable effective leadership participation.
+ Integrate Connected Ecosystem partners into pursuit strategy to expand capability and differentiation.
Content and Narrative Development
+ Support creation of pursuit materials and customer narratives that clearly communicate Lumen's transformation value.
+ Ensure materials are concise, data driven, and aligned with enterprise messaging.
Deal Readiness and Execution Discipline
+ Ensure all pursuits have clear action plans, aligned stakeholders, and transparent next steps.
+ Facilitate progress reviews focused on execution and outcomes, not reporting.
+ Maintain pace, quality, and alignment through the full pursuit cycle.
**What We Look For in a Candidate**
+ 5+ years of experience in enterprise deal strategy, commercial enablement, or complex pursuit roles
+ Strong understanding of enterprise sales cycles and multi stakeholder deal structure
+ Financial and commercial fluency with ability to evaluate deal health and structure
+ Excellent executive communication and analytical thinking skills
+ Proven credibility across Sales, Product, and Operations for practical, fact-based execution
+ Operates with urgency, accountability, and commercial intensity
**Compensation**
This information reflects the anticipated base salary range for this position based on current national data. Minimums and maximums may vary based on location. Individual pay is based on skills, experience and other relevant factors.
Location Based Pay Ranges
$134,946 - $179,928 in these states: AL AR AZ FL GA IA ID IN KS KY LA ME MO MS MT ND NE NM OH OK PA SC SD TN UT VT WI WV WY
$141,694 - $188,925 in these states: CO HI MI MN NC NH NV OR RI
$148,441 - $197,921 in these states: AK CA CT DC DE IL MA MD NJ NY TX VA WA
Lumen offers a comprehensive package featuring a broad range of Health, Life, Voluntary Lifestyle benefits and other perks that enhance your physical, mental, emotional and financial wellbeing. We're able to answer any additional questions you may have about our bonus structure (short-term incentives, long-term incentives and/or sales compensation) as you move through the selection process.
Learn more about Lumen's:
Benefits (****************************************************
Bonus Structure
**What to Expect Next**
Requisition #: 341124
**Background Screening**
If you are selected for a position, there will be a background screen, which may include checks for criminal records and/or motor vehicle reports and/or drug screening, depending on the position requirements. For more information on these checks, please refer to the Post Offer section of our FAQ page (************************************* . Job-related concerns identified during the background screening may disqualify you from the new position or your current role. Background results will be evaluated on a case-by-case basis.
Pursuant to the San Francisco Fair Chance Ordinance, we will consider for employment qualified applicants with arrest and conviction records.
**Equal Employment Opportunities**
We are committed to providing equal employment opportunities to all persons regardless of race, color, ancestry, citizenship, national origin, religion, veteran status, disability, genetic characteristic or information, age, gender, sexual orientation, gender identity, gender expression, marital status, family status, pregnancy, or other legally protected status (collectively, "protected statuses"). We do not tolerate unlawful discrimination in any employment decisions, including recruiting, hiring, compensation, promotion, benefits, discipline, termination, job assignments or training.
**Disclaimer**
The job responsibilities described above indicate the general nature and level of work performed by employees within this classification. It is not intended to include a comprehensive inventory of all duties and responsibilities for this job. Job duties and responsibilities are subject to change based on evolving business needs and conditions.
In any materials you submit, you may redact or remove age-identifying information such as age, date of birth, or dates of school attendance or graduation. You will not be penalized for redacting or removing this information.
Please be advised that Lumen does not require any form of payment from job applicants during the recruitment process. All legitimate job openings will be posted on our official website or communicated through official company email addresses. If you encounter any job offers that request payment in exchange for employment at Lumen, they are not for employment with us, but may relate to another company with a similar name.
$148.4k-197.9k yearly 16d ago
Corporate Territory Account Executive
Workshare, Inc.
Account executive job in Holmdel, NJ
Join the Legal Tech Revolution at Litera Are you ready to shape the future of how law is practiced? At Litera, we're leading the legal AI revolution. As pioneers at the forefront of legal technology, we're transforming how 2M+ legal professionals work every day at the world's top law firms and corporate legal departments through our cutting-edge, AI-driven portfolio of tools. From intelligent document drafting to predictive analytics, from automated workflows to advanced security governance, we deliver innovative solutions seamlessly within Microsoft 365 and across every device lawyers use. With 30+ years of relentless innovation and the majority of the world's largest law firms as our clients, we're just getting started. If you're passionate about building AI-forward solutions that scale globally and want your work to impact millions of legal professionals worldwide, this is your opportunity to be part of something extraordinary-help us continue revolutionizing legal technology and defining what's possible in the legal industry.
Overview: As a Territory AccountExecutive (NA) at Litera, you will be part of a dynamic team that is passionate about driving innovation in the legal technology space. You will have the opportunity to work with cutting-edge tools and collaborate with industry experts to deliver solutions that make a real difference in the legal profession.
Key Responsibilities:
* Attain monthly and quarterly sales targets
* Earn credibility as a trusted advisor for key contacts within each customer in your territory
* Actively listen, understand customer objectives, and articulate relevant technology and business trends and benefits
* Develop detailed territory and account plans by working cross-functionally
* Expand relationships and grow our partnership within each customer
* Prospect into current customer accounts for cross-sell opportunities
Qualifications:
* You are energized by navigating complex organizations and decision-making processes
* You can earn credibility as a trusted advisor with C-suite and senior leaders within large global organizations
* You have a strong desire to learn about and evangelize technology solutions to challenging business problems
* You are keen on organization, collaboration, getting things done, and routinely meet metric-based quota goals
* Comfortable with a quickly changing environment
* Thrive on open transparency, communication, and collaboration internally and externally
* Competency with Salesforce, Excel, Teams, PowerPoint
* Locations: Austin, Boston, Chicago, Denver, NYC, NJ or Raleigh
As part of our strategic growth and commitment to enhancing our operational flexibility, we are excited to announce our transition to a hybrid working model. We will be establishing offices in Austin, Boston, Chicago, Denver, New York City, Philadelphia, New Jersey, Raleigh and Toronto. These cities will serve as key hubs for our operations. We are actively seeking talented individuals to join our team and support this dynamic shift. Candidates interested in these opportunities should reside within a reasonable commuting distance from one of these future office locations, as employees will be expected to work from the office at least three days a week. This approach will enable us to cultivate a collaborative and innovative environment while providing the flexibility that modern work demands.
Why Join Litera?
* The company culture: We emphasize helping each other grow, doing the right thing always, and being part of a journey to amplify impact, creating an exciting and fulfilling work environment
* Commitment to Employees: Our people commitment is based on what employees love most about being part of the team, focusing on tools that matter to the difference-makers in the legal world and amplifying their impact
* Global, Dynamic, and Diverse Team: Our is a global company with ambitious goals and unlimited opportunities, offering a dynamic and diverse work environment where employees can grow, listen, empathize, and problem-solve together
* Comprehensive Benefits Package: Experience peace of mind with our health insurance, retirement savings plans, generous paid time off, and a supportive work-life balance. We invest in your well-being and future, ensuring a rewarding career journey.
* Career Growth and Development: We provide career paths and opportunities for professional development, allowing employees to progress through various technical and leadership roles
Pay Transparency Notice for New Jersey Applicants:
The annual salary range for this position is $24/HR ($50K Annualized) to $36/hr ($75k annualized) with a $100k to $150k OTE. Actual compensation is determined by factors including education, work experience, certifications, and other relevant qualifications. Litera offers a comprehensive benefits package including health, dental, and vision insurance, 401(k) with company contribution, and incentive and recognition programs. All benefits are subject to eligibility requirements.
Litera is an equal opportunity employer. We celebrate diversity and are committed to creating an inclusive environment for all employees.
$100k-150k yearly Auto-Apply 60d+ ago
Enterprise Account Executive
UKG 4.6
Account executive job in Trenton, NJ
With 80,000 customers across 150 countries, UKG is the largest U.S.-based private software company in the world. And we're only getting started. Ready to bring your bold ideas and collaborative mindset to an organization that still has so much more to build and achieve? Read on.
At UKG, you get more than just a job. You get to work with purpose. Our team of U Krewers are on a mission to inspire every organization to become a great place to work through our award-winning HR technology built for all.
Here, we know that you're more than your work. That's why our benefits help you thrive personally and professionally, from wellness programs and tuition reimbursement to U Choose - a customizable expense reimbursement program that can be used for more than 200+ needs that best suit you and your family, from student loan repayment, to childcare, to pet insurance. Our inclusive culture, active and engaged employee resource groups, and caring leaders value every voice and support you in doing the best work of your career. If you're passionate about our purpose - people -then we can't wait to support whatever gives you purpose. We're united by purpose, inspired by you.
UKG is seeking a highly motivated Enterprise AccountExecutive, who will be responsible for net-new logo sales in our S&D West business segment. While each AE owns a few upsell accounts, this is a true Hunter role.
If you are a highly successful HRMS/Payroll salesperson and have followed the growing success of our company, then you know that we rarely have an opening in our sales ranks. Why? Because we hire only the best HRMS/Payroll Reps and arm them with the best products, support personnel, and tools to ensure long-term success with us. Now it's your turn for an opportunity to build your sales legacy: we are expanding our sales force and are looking for the very best to represent UKG.
**About You:**
- 5-7+ years proven success selling cloud/SaaS solutions to C level. HRMS/Payroll experience a strong plus.
- Consistently exceed a $2 Million+ quota
- 3+ years selling complex deals over $800K in ARR
- Demonstrated experience building a territory and pipeline from scratch
- Consistently execute a thoughtful, strategic sales process including internal business partners and executive engagement.
Challenging? Yes! UKG expects a lot of our AE's and we provide a lot for our reps to succeed:
- Tenured management who are skilled at guiding highly successful sales personnel
- Seasoned Application Consultant team to assist with proposals, RFPs, and demos
- Expert Technical Sales Support
- Highly reference-able customer base with 96% customer retention with our hosted SaaS solution
- Solid Sales Operations and Legal staff focused on helping process and close contracts quickly
- Award-winning HRMS/Payroll, Talent Management, and Time and Attendance solutions, consistently outperforming our competitors' products
- Software-as-a-Service solution for the growing number of companies relying upon SaaS benefits
- Award-winning Implementation and Customer Support teams dedicated to bringing customers live in industry-record timeframes
- A company culture that breeds and supports success at every level, putting our employees first!
Rewarding? Absolutely! You will have confidence in the performance of the solutions you sell and also in the quality of service your customers will receive, ensuring your accounts will be satisfied with their decision to go with UKG. UKG offers generous escalating commission percentages, and club locations are luxurious.
**Travel Requirement:**
- 30-40%
**Where We're Going:**
UKG is on the cusp of something truly special. Worldwide, we already hold the #1 market share position for workforce management and the #2 position for human capital management. Tens of millions of frontline workers start and end their days with our software, with billions of shifts managed annually through UKG solutions today. Yet it's our AI-powered product portfolio designed to support customers of all sizes, industries, and geographies that will propel us into an even brighter tomorrow!
**Pay Transparency:**
The base salary range for this position is $140,000 annually; however, base pay offered may vary depending on skills, experience, job-related knowledge and location. This position is also eligible for commissions and restricted stock unit awards as part of an industry leading total compensation package. Information about UKG's comprehensive benefits can be reviewed on our careers site at *************************** .
**Equal Opportunity Employer:**
UKG is an equal opportunity employer. We evaluate qualified applicants without regard to race, color, disability, religion, sex, age, national origin, veteran status, genetic information, and other legally protected categories.
View **The EEO Know Your Rights poster (************************************************************************************************** **
UKG participates in E-Verify. View the E-Verify posters **here (******************************************************************************************** . **
It is unlawful in Massachusetts to require or administer a lie detector test as a condition of employment or continued employment. An employer who violates this law shall be subject to criminal penalties and civil liability.
**Disability Accommodation in the Application and Interview Process:**
For individuals with disabilities that need additional assistance at any point in the application and interview process, please email ****************** .
It is the policy of Ultimate Software to promote and assure equal employment opportunity for all current and prospective Peeps without regard to race, color, religion, sex, age, disability, marital status, familial status, sexual orientation, pregnancy, genetic information, gender identity, gender expression, national origin, ancestry, citizenship status, veteran status, and any other legally protected status entitled to protection under federal, state, or local anti-discrimination laws. This policy governs all matters related to recruitment, advertising, and initial selection of employment. It shall also apply to all other aspects of employment, including, but not limited to, compensation, promotion, demotion, transfer, lay-offs, terminations, leave of absence, and training opportunities.
$140k yearly 60d+ ago
Territory Account Executive, SMB - Toms River, NJ
Toast 4.6
Account executive job in Toms River, NJ
Toast is driven by building the restaurant platform that helps restaurants adapt, take control, and get back to what they do best: building the businesses they love.
As a Territory Sales AccountExecutive, you will be part of a team that is transforming the way restaurants operate. Using a consultative approach, you will prospect, build relationships, and sign up new restaurateurs in your local area. By understanding their unique needs, you will develop a customized solution that helps their business thrive. We need your passion and expertise to help us build the Toast brand in your geographic territory.
This is a field sales opportunity based out of a personal home office. You must live local to your territory or be willing to relocate to the area.
About this roll*: (Responsibilities)
Generate list of prospective restaurants and manage the entire sales cycle from initial call to close
Conduct demos and develop a solution that best meets the prospect's needs
Partner with teams across the business to ensure that expectations set during the sales process are met in delivery
Leverage Salesforce (our CRM) to manage all sales activities
Understand the competitive landscape and determine how to best position Toast in the market
Do you have the right ingredients*? (Requirements)
1+ years of experience in a sourcing or closing sales role, restaurant operations, or a relatable field and industry
Since this is a field position, you must have reliable transportation (will reimburse for mileage)
Strong communication, organizational and presentation skills with the ability to sell and negotiate at all decision-making levels
Proven track record of success in meeting and exceeding goals
Ability to work in a fast-paced, entrepreneurial and team environment
Self-motivated, creative, and flexible
General technical proficiency with software
Special Sauce* (Nice to Haves)
Experience with Salesforce CRM
Sandler Sales Training
AI at Toast
At Toast we're Hungry to Build and Learn. We believe learning new AI tools empowers us to build for our customers faster, more independently, and with higher quality. We provide these tools across all disciplines, from Engineering and Product to Sales and Support, and are inspired by how our Toasters are already driving real value with them. The people who thrive here are those who embrace changes that let us build more for our customers; it's a core part of our culture.
Our Spread* of Total Rewards
We strive to provide competitive compensation and benefits programs that help to attract, retain, and motivate the best and brightest people in our industry. Our total rewards package goes beyond great earnings potential and provides the means to a healthy lifestyle with the flexibility to meet Toasters' changing needs. Learn more about our benefits at ********************************************
*Bread puns encouraged but not required
The estimated Total Targeted Cash compensation range for this role is listed below. Total Targeted Cash for this role consists of a base salary, commission, benefits, and equity (if eligible). This role qualifies for uncapped commissions. The starting salary will be determined based on skills, experience, and geographic location.
Total Targeted Cash$129,000-$206,000 USD
How Toast Uses AI in its Hiring Process
Throughout the hiring process, our goal is to get to know you. We use AI tools to support our recruiters and interviewers with tasks like note-taking, summarization, and documentation of interviews to ensure they can be fully focused on your conversation. All hiring decisions are made by people.
Diversity, Equity, and Inclusion is Baked into our Recipe for Success
At Toast, our employees are our secret ingredient-when they thrive, we thrive. The restaurant industry is one of the most diverse, and we embrace that diversity with authenticity, inclusivity, respect, and humility. By embedding these principles into our culture and design, we create equitable opportunities for all and raise the bar in delivering exceptional experiences.
We Thrive Together
We embrace a hybrid work model that fosters in-person collaboration while valuing individual needs. Our goal is to build a strong culture of connection as we work together to empower the restaurant community. To learn more about how we work globally and regionally, check out: *********************************************
Apply today!
Toast is committed to creating an accessible and inclusive hiring process. As part of this commitment, we strive to provide reasonable accommodations for persons with disabilities to enable them to access the hiring process. If you need an accommodation to access the job application or interview process, please contact candidateaccommodations@toasttab.com.
------
For roles in the United States, it is unlawful in Massachusetts to require or administer a lie detector test as a condition of employment or continued employment. An employer who violates this law shall be subject to criminal penalties and civil liability.
$42k-99k yearly est. Auto-Apply 60d+ ago
Enterprise Account Executive - East - Financial Services
A10 Networks 4.8
Account executive job in Trenton, NJ
The Enterprise AccountExecutive (EAE) is a hybrid hunter/generalist responsible for driving new business while managing a defined portion of assigned install base accounts. While primarily a hunter role (with high hunting intensity), the EAE, must be able to manage, renew, grow, and support select existing customers. EAEs manage transactional through mid-to-large enterprise opportunities, competitive takeouts, and expansion opportunities within their assigned territory. This Individual will be focused on positioning A10's technology into new accounts in the Financial Services market segment.
Key Responsibilities
Hunting and Pipeline Generation:
* Actively hunt for new enterprise opportunities through outbound prospecting, partner collaboration, and market intelligence
* Execute high-intensity hunting activities to drive net-new customer acquisition
* Build a strong top-of-funnel pipeline aligned to territory goals
Account Management:
* Manage and grow assigned install base accounts including renewals, cross-sell, and upsell
* Identify, qualify, and close business opportunities with Financial Services accounts
* Own renewals, cross-sell, and upsell activities within your assigned customer set
* Maintain regular facetime and appointment activity to drive customer engagement
Sales Execution:
* Drive full sales cycles including discovery, solution positioning, proposal development pricing, and negotiations
* Navigate mixed deal complexity (midsized to large opportunities)
* Engage with Director-VP level executives across customer organizations
* Drive competitive displacement strategies to replace legacy ADC/security vendors
Territory Management:
* Build a balanced a balanced territory business plan combining aggressive hunting targets and customer expansion
* Maintain comprehensive visibility and accurate forecasting in Salesforce (SFDC)
* Work effectively with channel partners to expand reach and accelerate deal cycles
Key Performance Indicators (KPIs)
* Net-new business and pipeline creation
* Deal velocity and conversion rates
* Face time and appointment activity
* Channel engagement and co-selling
* Forecast accuracy and territory coverage
Candidate Qualifications
* 5-10 years enterprise or mid-market sales experience
* Proven success in sales roles within the Financial Services market focusing on network infrastructure, security, or enterprise software solutions
* Strong balance of new logo hunting and account management skills
* Experience selling networking, security, SaaS, and/or infrastructure solutions
* Proven skills in discovery, presentation, qualification, and closing
* High proficiency in Salesforce SFDC and territory planning
Educational and Professional Requirements:
* Bachelor's degree or equivalent work experience
* Excellent written and verbal communication skills, including formal presentation capabilities
* Self-motivated and results-driven, with the ability to work effectively under pressure
* Strong strategic planning skills to build stable business streams
A10 Networks is an equal opportunity employer and a VEVRAA federal subcontractor. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, disability status, protected veteran status, or any other characteristic protected by law. A10 also complies with all applicable state and local laws governing nondiscrimination in employment.
#LI-AN1 - Remote
Targeted compensation guideline: $300,000 - $320,000. Compensation will vary based on number of factors, including market demand for specific skills, role type, job level, and individual qualifications. Final salary offers are determined by considerations including, but not limited to, subject matter expertise, demonstrated skill level, relevant experience, geographic location, education, certifications, and training.
$300k-320k yearly Auto-Apply 8d ago
Business Development
Coretitle
Account executive job in Mount Laurel, NJ
CORE is currently seeking a hardworking and experienced Title Insurance Sales Representative. Join one of South Jersey's fastest growing title companies and most successful title team! Whether you have a well-established client base or need help taking your business to the next level, we want to meet.
Increase overall resale and refinance market share in the New Jersey and Pennsylvania market by building strong relationships with REALTORS, mortgage brokers and loan originators, banks, credit unions. Team player who acts as the liaison between the inside office staff and clients in the field.
Must be confident in making cold calls, prospecting for leads, as well as maintaining current customer's needs. Strong social media presence is a plus. Develop and initiate new sales and marketing ideas. Actively pursue office presentations with office brokers and staff
Knowledge of real estate business is extremely helpful. Consistently increase business and revenues Candidate must possess the following: Strong work ethic. Must provide own reliable transportation. Superior time management skills OTHER REQUIREMENTS:
Attending outside functions both during the day and some evenings Excellent interpersonal communication skills (both written and verbal) Ability to effectively present information one-on-one and in group settings Maintain a professional appearance and providing a positive company image
EDUCATION:
Minimum High School or equivalent (required) Degree in Sales and Marketing (preferred)
EXPERIENCE:
2-5 years of successful sales experience in the Real Estate industry
Salary is commensurate with experience
Job Type: Full-time
$76k-120k yearly est. 60d+ ago
Landscape Business Development - South Jersey
Gras Lawn
Account executive job in Beverly, NJ
Job DescriptionSalary:
Gras Lawn, a commercial landscape company, is seeking an experienced Landscape Business Developer for the South Jersey Market. Your main responsibility is developing business with potential new customers, building and maintaining trusted relationships with key decision-makers, understanding their challenges, and creating value solutions. Your role also involves effectively identifying opportunities, gathering valuable intelligence, creating customer-centric proposals, collaborating with team members, meeting specific activity targets, and closing deals.
The Business Developer focuses on strengthening Gras Lawns market presence and driving profitable growth. This position plays a key role in meeting long-term strategic objectives by fostering important customer relationships, identifying business opportunities, negotiating and closing deals, and maintaining a comprehensive understanding of the current market landscape.
Identifyandunderstandthechallengesofprospectiveclientsanddevelopsolutions.
Provideaccurateforecastsforsales,deliverables,andkeyperformanceindicators(KPIs).
Achievesalesgoalswhilehavingtheabilitytoworkindependently.
Usesalestechniquestofindnewcustomersandbuildlong-termbusinessrelationships.Also,focusonmarketingandpricingstrategies.
Conductphoneprospecting,salespresentations,virtualdemonstrations,andcontractnegotiationswithminimalsupervision.
Identifycustomerneedsandapplysolution-basedsellingtechniquestodemonstratethevalueof GrasLawnsserviceseffectively.
Buildandnurturerelationshipswithpotentialandcurrentclients.
Planyourdailyactivitiesandaimtomeetspecificperformancebenchmarkstoclosebusinessdealssuccessfully.
ConsistentlyandreliablylogactivitiesintheCRM.
Workeffectivelyinafast-pacedenvironmentwhilemaintainingastrongsenseofurgency.
Communicateproactivelywithallclients,prospects,andcolleagues.
SkillsRequired:
ExtensiveexperienceintheCommercialLandscapeIndustry
Proventrackrecordofsalesgoalattainmentandpipelinemanagement
3-5yearsofexperienceinB2Bsalesatmid-to-seniorlevels.
Localknowledgeandcontactsinoneormoremarketsegments
Proficientwithcomputerprograms,including AspireandaCRMtool
Highlycompetitive,positive,andresults-driven
Exceptionalmultitasker.
Excellentoralandwrittencommunicationabilities,strongpresentationskills,andprofessionalexperiencewithsocialmedia.
Passionate,organized,andresourcefulindividualwithoutstandinglisteningandinterpersonalskills.
Highly organized, self-motivated, and hardworking, with effective time management capabilities.
Easilyadaptabletonewsituations.
Salary commensurate with experience.
Youwillberesponsiblefor:
TheBusinessDeveloperoverseesthesalespipelinefromtheprospectingstagetoclosingandisaccountablefortheentiresalescycle,includingsnowsalesincertainregions.Additionally,the BusinessDeveloperworksincollaborationwithpartnersacrossoperations,finance,marketing,andotherdepartmentstoeffectivelyrespondtobidsandachievesalesgoals.
Salary commensurate with experience.
$76k-120k yearly est. 20d ago
HVAC Sales Rep/Comfort Consultant
Harris Heating, Plumbing, Air & Electric
Account executive job in Mount Laurel, NJ
Harris Plumbing, Heating, Air, & Electrical is a growing, full-service residential plumbing, heating, air and electrical company located in NJ, PA and DE. Locally-owned and operated, our team provides homeowners in the Tri-State with 5-star residential home services, all delivered through a proven, customer-focused service system.
We are currently searching for an Outside Sales Rep:
Outside Sales Representatives connect customers with comfort through simple heating, cooling, and air quality upgrades, or whole system replacements. We have the installation crews available for next-day service, multiple financing options, and the strongest guarantee in the business. At Harris Plumbing, Heating, Air, & Electrical, the value of your customer service delivery will never go unnoticed, the opportunity for career advancement is abundant and the income potential is unlimited.
Responsibilities/Experience:
Prior experience selling residential services in home. Some locations may require HVAC specific experience.
Ability to travel to pre-set appointments throughout your assigned area in company provided work vehicle.
A proven work ethic with excellent customer service and communication skills.
Willingness to put in long, sporadic hours and/or weekends as needed.
Willingness to go into attics and crawl spaces on a regular basis.
All candidates are required to undergo pre-employment drug screen, background checks and must have a valid driver's license with good driving record.
Must be 21 years of age or older
We Offer:
Medical, dental, and vision benefits
Exceptional 401(k) savings plan
Paid holidays and vacation
Steady, year-round work
Training and potential for career growth
Job Type: Full-time
Benefits:
401(k) matching
Dental insurance
Health insurance
Life insurance
Paid time off
Vision insurance
$213k-303k yearly est. 58d ago
Business Developer, Commercial Landscape and Snow Services
Braveview, Inc.
Account executive job in Piscataway, NJ
Job Description
BraveView has been engaged by a growing $14mm Commercial Landscape company in the Piscataway, NJ market to recruit and hire an experienced Business Developer to join their organization. Ideally, this person should target the Northern part of the NJ market and look for opportunities that fit our company's criteria.
Title: Business Developer
Category: Full Time, Salary
Salary: $75,000 - $85,000 based on skill & experience plus sales commissions.
Job Summary:
The Commercial Landscape Business Developer is responsible for driving revenue growth by identifying, pursuing, and securing commercial landscape maintenance contracts. This role focuses on building and maintaining strong client relationships, generating leads, and closing sales for landscape maintenance services.
The ideal candidate is a proactive, results-driven professional with strong sales skills and knowledge of the landscaping industry.
Key Responsibilities:
Lead Generation: Identify and target potential commercial clients, such as property managers, HOAs, corporate campuses, retail centers, and municipalities, through cold calling, networking, referrals, and industry events.
Client Relationship Management: Build and maintain long-term relationships with clients, understanding their needs and providing tailored landscape maintenance solutions.
Sales Process: Develop and present proposals, negotiate contract terms, and close deals for recurring maintenance contracts and additional services.
Market Research: Stay informed about industry trends, competitor offerings, and local market opportunities to position the company competitively.
Site Assessments: Conduct site visits to evaluate client properties, assess landscaping needs, and provide accurate cost estimates and service plans.
Collaboration: Work closely with operations and account management teams to ensure seamless service delivery and client satisfaction post-sale.
CRM Management: Maintain accurate records of sales activities, client interactions, and pipeline progress using CRM software.
Revenue Goals: Meet or exceed quarterly and annual sales targets for maintenance contracts and upsell opportunities.
Qualifications:
Bachelor's degree in business, horticulture, landscape management, or related field (preferred but not required).
3+ years of B2B sales experience, preferably in landscaping, facilities management, or a related industry.
Strong understanding of commercial landscaping services, including maintenance, irrigation, and seasonal care.
Proven track record of meeting or exceeding sales quotas.
Excellent communication, negotiation, and presentation skills.
Ability to build rapport and trust with diverse clients, including property managers, HOA boards and corporate decision-makers.
Proficiency in CRM software and Microsoft Office.
Valid driver's license and ability to travel to client sites.
Preferred Skills:
Knowledge of local plants, climate, and landscaping best practices.
Experience in creating and delivering compelling proposals and bids.
Familiarity with commercial property management or real estate sectors.
Compensation & Benefits:
Competitive base salary plus commission.
Health, dental, and vision insurance.
Company vehicle or mileage reimbursement.
Paid time off and holidays.
401k
Opportunities for professional development and career growth.
If you are qualified and interested, please respond to this job posting by sending us a copy of your resume.
#ZR
$75k-85k yearly 7d ago
Business Developer, Commercial Landscape and Snow Services
Braveview
Account executive job in Piscataway, NJ
BraveView has been engaged by a growing $14mm Commercial Landscape company in the Piscataway, NJ market to recruit and hire an experienced Business Developer to join their organization. Ideally, this person should target the Northern part of the NJ market and look for opportunities that fit our company's criteria.
Title: Business Developer
Category: Full Time, Salary
Salary: $75,000 - $85,000 based on skill & experience plus sales commissions.
Job Summary:
The Commercial Landscape Business Developer is responsible for driving revenue growth by identifying, pursuing, and securing commercial landscape maintenance contracts. This role focuses on building and maintaining strong client relationships, generating leads, and closing sales for landscape maintenance services.
The ideal candidate is a proactive, results-driven professional with strong sales skills and knowledge of the landscaping industry.
Key Responsibilities:
Lead Generation: Identify and target potential commercial clients, such as property managers, HOAs, corporate campuses, retail centers, and municipalities, through cold calling, networking, referrals, and industry events.
Client Relationship Management: Build and maintain long-term relationships with clients, understanding their needs and providing tailored landscape maintenance solutions.
Sales Process: Develop and present proposals, negotiate contract terms, and close deals for recurring maintenance contracts and additional services.
Market Research: Stay informed about industry trends, competitor offerings, and local market opportunities to position the company competitively.
Site Assessments: Conduct site visits to evaluate client properties, assess landscaping needs, and provide accurate cost estimates and service plans.
Collaboration: Work closely with operations and account management teams to ensure seamless service delivery and client satisfaction post-sale.
CRM Management: Maintain accurate records of sales activities, client interactions, and pipeline progress using CRM software.
Revenue Goals: Meet or exceed quarterly and annual sales targets for maintenance contracts and upsell opportunities.
Qualifications:
Bachelor's degree in business, horticulture, landscape management, or related field (preferred but not required).
3+ years of B2B sales experience, preferably in landscaping, facilities management, or a related industry.
Strong understanding of commercial landscaping services, including maintenance, irrigation, and seasonal care.
Proven track record of meeting or exceeding sales quotas.
Excellent communication, negotiation, and presentation skills.
Ability to build rapport and trust with diverse clients, including property managers, HOA boards and corporate decision-makers.
Proficiency in CRM software and Microsoft Office.
Valid driver's license and ability to travel to client sites.
Preferred Skills:
Knowledge of local plants, climate, and landscaping best practices.
Experience in creating and delivering compelling proposals and bids.
Familiarity with commercial property management or real estate sectors.
Compensation & Benefits:
Competitive base salary plus commission.
Health, dental, and vision insurance.
Company vehicle or mileage reimbursement.
Paid time off and holidays.
401k
Opportunities for professional development and career growth.
If you are qualified and interested, please respond to this job posting by sending us a copy of your resume.
#ZR
$75k-85k yearly 60d+ ago
In Home Design Consultant Sales Representative
Bath Planet
Account executive job in Old Bridge, NJ
Job Description
No Experience Necessary!! We will train motivated individuals. A Unique opportunity to make once in a lifetime money right here in New Jersey! Bathroom Pros is growing its local operation. Our top earners in the organization can earn north of 200 K per year. Our first-year representatives can earn between 100k and 180k per year. We are not looking for experienced home-improvement salespeople. We are willing to train the right candidates for this incredible opportunity. Sales experience is a plus but not required.
Bathroom Pros is locally owned and operated in Toms River, New Jersey but we sell and install Bathrooms in all areas of New Jersey. It's no accident that we've become one of the most trusted bathroom remodelers in New Jersey. We've FIRMLY adhered to a set of customer-focused Core Values since the day we opened. And the result has been over-the-moon homeowners throughout the Garden State.
We sell bathroom remodeling to people that need it! Our customers range from elderly folks looking for safe and accessible bathing to first time homeowners needing to remodel an outdated bathroom. We sell a unique product line made exclusively right here in the USA, by hard-working Americans. We provide preset appointments from our expert marketing team. There is no door knocking or canvassing. You will get qualified leads to run.
Successful candidates will be money motivated, driven and extremely hard-working. This is not a job for the faint of heart. You will have to work, and sometimes pretty hard. Some pretty long days too. But you will make more Money than you've ever dreamed.
Stop waiting and get your résumé over to us now.
************
(Must be able to pass background check)
Job Type: Full-time
Pay: $100,000.00 - $180,344.00 per year
Powered by JazzHR
AcH5JlnDeX
$100k-180.3k yearly 12d ago
Business Development - Product Sales
Approved Fire Protection Co Inc.
Account executive job in Somerset, NJ
Job DescriptionDescription:
About Us:
Approved Fire Protection Co. is New Jersey's oldest family-owned, full-service fire protection and safety equipment company. Our services include fire extinguishers, alarm systems, suppression systems, SCBA, gas detection, carbon dioxide, oxygen, sprinkler systems, access control, CCTV, and so much more. Approved Fire Protection's mission is to supply life safety and security products and services to the industrial, commercial, pharmaceutical, and municipal companies in New Jersey and near surrounding areas.
Job Summary:
We are seeking a driven, high-energy New Business Sales Representative to aggressively grow our portable gas meter, SCBA, & PPE divisions. This role is focused on pure hunting and outbound prospecting, building new relationships, driving first-time appointments, and converting opportunities into revenue. The ideal candidate thrives on activity, embraces cold outreach, and excels at opening new doors through phone calls, LinkedIn messaging, email campaigns, networking, and in-person site visits.This individual will represent our full line of SCBA, portable gas meters, and PPE products and services-while educating customers on compliance, safety, and risk reduction. Success in this role is measured by daily/weekly outbound activity, KPI targets, pipeline growth, and consistent quota attainment. If you are competitive, motivated by new business generation, and excel in fast-paced sales environments, this position offers strong earning potential, autonomy, and the opportunity to make a meaningful impact on customer safety and security.
Benefits:
Medical, Dental, Vision, HSA
401k with company contributions
Life Insurance
Long term disability
Long Term Care Insurance
Summer Hours Program
Profit Sharing
Mileage Reimbursement
PTO
Salary:
$55k - $65K base salary plus uncapped commissions, car package, bonus, profit sharing
Requirements:
Prior experience in the fire protection industry or PPE sales is preferred.
Prior outside sales experience is a MUST.
Able to travel to customer sites throughout your territory.
Excellent communication, negotiation, and interpersonal skills via email, text message, a phone.
Valid driver's license and excellent driving record.
Must pass a background check and pre-employment drug screen.
Excellent customer service skills.
Continuing education as training/ seminars arises
Must be able to work Monday through Friday 7:20 am - 4:20 PM
Language: Must be able to read, write in English
$55k-65k yearly 6d ago
Entry Level Sales and Marketing Representative
Kinetic Innovations
Account executive job in Burlington, NJ
Are you ambitious, self-driven, and thrive in a team environment? Do you want a successful career with growth and potential for leadership? Here at Solar pros, we are looking for talented professionals with an entrepreneurial mindset who want to build their career and income to the next level! We're looking for individuals eager to learn and grow in the solar industry, as we guide you to reach your full potential. Our ideal candidate is self-driven, enjoys working with others, and is passionate about mastering the various aspects of solar energy.
Opportunities For Advancement
As a full-time Sales and Marketing Representative, we are preparing you to succeed in more than just the position you are hired into. We combine training with hands-on sales experience led by the top performers in the industry. We make it a top priority to provide the best training as you begin your career, and throughout your career here with us. Apply now if you are looking to position yourself in a high growth, world changing career!
Responsibilities:
Provide exceptional customer service face to face with potential homeowners
Build strong relationships with customers, teammates and clients
Speak with customers regarding solar energy and generate awareness and interest on products and services
Cross departmental collaboration and training
Requirements:
Positive attitude and strong work ethic
Student mentality
Passion for building relationships
Excellent communication skills
Availability to work Saturday
Benefits:
Development and training in a rapidly growing industry
Strong leadership that is dedicated to sales support
Daily Meetings
Team nights
Varied pay
The ability to create your own career path
Join our team, where hard work is balanced with play, victories are celebrated, and growth is a constant journey. Together, we're building a brighter, more sustainable future-one solar solution at a time.
Job Type: Full-time
Pay: $80,000.00 - $100,000.00 per year
Schedule:
Work schedule: Tuesday- Saturday
Monday (optional)
Work Location: In person Compensation: $80,000.00 - $100,000.00 per year
Unique marketing solutions with unmatched results Many reputable companies choose to work with Kinetic Innovations because we are problem solvers at the highest level. Personal connection is what sales are all about. Our learnings from Kinetic Innovations have taught us one thing: when people help people, everyone wins.
$80k-100k yearly Auto-Apply 60d+ ago
Corporate Account Executive
Workshare, Inc.
Account executive job in Holmdel, NJ
Join Our Team at Litera: Where Legal Technology Meets Excellence Litera has been at the forefront of legal technology innovation for over 25 years, crafting legal software to amplify impact and maximize efficiency. Developed by the best legal minds in the industry, our comprehensive suite of integrated legal tools is both powerful and user-friendly and simplifies the way modern firms manage core legal workflows, secure collaboration, and organize firm knowledge and experience. Every day, we help more than 2.3 million legal professionals focus on their craft. Litera: Less busy work, more of your life's work.
Overview: As a Corporate AccountExecutive at Litera, you will be part of a dynamic team that is passionate about driving innovation in the legal technology space. You will have the opportunity to work with cutting-edge tools and collaborate with industry experts to deliver solutions that make a real difference in the legal profession.
Key Responsibilities:
* Attain monthly and quarterly sales targets
* Earn credibility as a trusted advisor for key contacts within each customer in your territory
* Actively listen, understand customer objectives, and articulate relevant technology and business trends and benefits
* Develop detailed territory and account plans by working cross-functionally
* Expand relationships and grow our partnership within each customer
* Prospect into current customer accounts for cross-sell opportunities
Qualifications:
* You have sold SaaS to law firm, legal, and/or equivalent personas
* 5+ years of sales career progression
* You have demonstrable success in hitting and exceeding sales quotas
* You are energized by navigating complex organizations and decision-making processes
* You quickly learn and evangelize technology solutions to challenging business problems
* You are keen on organization, collaboration, and getting things done
* Comfortable with a quickly changing environment
* Thrive on open transparency, communication, and collaboration internally and externally
* Competency with Salesforce, Excel, Teams, PowerPoint
Why Join Litera?
* The company culture: We emphasize helping each other grow, doing the right thing always, and being part of a journey to amplify impact, creating an exciting and fulfilling work environment
* Commitment to Employees: Our people commitment is based on what employees love most about being part of the team, focusing on tools that matter to the difference-makers in the legal world and amplifying their impact
* Global, Dynamic, and Diverse Team: Our is a global company with ambitious goals and unlimited opportunities, offering a dynamic and diverse work environment where employees can grow, listen, empathize, and problem-solve together
* Comprehensive Benefits Package: Experience peace of mind with our health insurance, retirement savings plans, generous paid time off, and a supportive work-life balance. We invest in your well-being and future, ensuring a rewarding career journey.
* Career Growth and Development: We provide career paths and opportunities for professional development, allowing employees to progress through various technical and leadership roles
Pay Transparency Notice for New Jersey Applicants:
The annual salary range for this position is $100,000 to $125,000 with an OTE of $200k to $250k. Actual compensation is determined by factors including education, work experience, certifications, and other relevant qualifications.
Litera offers a comprehensive benefits package including health, dental, and vision insurance, 401(k) with company contribution, and incentive and recognition programs. All benefits are subject to eligibility requirements.
Litera is an equal opportunity employer. We celebrate diversity and are committed to creating an inclusive environment for all employees.
$100k-125k yearly Auto-Apply 60d+ ago
Entry Level Sales and Marketing Representative
Kinetic Innovations
Account executive job in Burlington, NJ
Job DescriptionAre you ambitious, self-driven, and thrive in a team environment? Do you want a successful career with growth and potential for leadership? Here at Solar pros, we are looking for talented professionals with an entrepreneurial mindset who want to build their career and income to the next level! Were looking for individuals eager to learn and grow in the solar industry, as we guide you to reach your full potential. Our ideal candidate is self-driven, enjoys working with others, and is passionate about mastering the various aspects of solar energy.
Opportunities For Advancement
As a full-time Sales and Marketing Representative, we are preparing you to succeed in more than just the position you are hired into. We combine training with hands-on sales experience led by the top performers in the industry. We make it a top priority to provide the best training as you begin your career, and throughout your career here with us. Apply now if you are looking to position yourself in a high growth, world changing career!
Responsibilities:
Provide exceptional customer service face to face with potential homeowners
Build strong relationships with customers, teammates and clients
Speak with customers regarding solar energy and generate awareness and interest on products and services
Cross departmental collaboration and training
Requirements:
Positive attitude and strong work ethic
Student mentality
Passion for building relationships
Excellent communication skills
Availability to work Saturday
Benefits:
Development and training in a rapidly growing industry
Strong leadership that is dedicated to sales support
Daily Meetings
Team nights
Varied pay
The ability to create your own career path
Join our team, where hard work is balanced with play, victories are celebrated, and growth is a constant journey. Together, were building a brighter, more sustainable futureone solar solution at a time.
Job Type: Full-time
Pay: $80,000.00 - $100,000.00 per year
Schedule:
Work schedule: Tuesday- Saturday
Monday (optional)
Work Location: In person
How much does an account executive earn in Lakewood, NJ?
The average account executive in Lakewood, NJ earns between $43,000 and $110,000 annually. This compares to the national average account executive range of $44,000 to $109,000.
Average account executive salary in Lakewood, NJ
$69,000
What are the biggest employers of Account Executives in Lakewood, NJ?
The biggest employers of Account Executives in Lakewood, NJ are: