Post job

Business advisor jobs in Bensalem, PA - 558 jobs

All
Business Advisor
Business Developer
Business Specialist
Business Consultant
Business Strategist
Business To Business Sales Consultant
Senior Business Consultant
Business Internship
Management Consultant
Business Development Associate
  • Business Development - Kitchen and Bath Industry

    Hafele Brand 4.3company rating

    Business advisor job in Philadelphia, PA

    Häfele America Co. at a quick glance: We are the largest subsidiary of a privately-held, a global powerhouse in the areas of LED lighting, cabinet and furniture hardware, kitchen organization and much more. We offer a strong benefits package including medical, dental, 401(k) with company match, employee discount and other perks. There's a very good reason 41% of our employees have been with us for over ten years - we hire the best, treat people well and truly provide a family atmosphere that works hard and plays to win. KEY RESPONSIBILITIES include the following. Other duties may be assigned. Defined territory consists of kitchen manufacturers and dealers in Eastern, PA. (Role is based is based in PA) Grow and manage sales within assigned accounts, developing strong relationships across Purchasing, Operations, Marketing, and Leadership. Identify and pursue new business with underdeveloped kitchen manufacturers. Promote Hafele's full product offering, including functional hardware, kitchen organization, fasteners, and lighting. Collaborate with internal teams and dealer networks to ensure aligned efforts and maximize sales opportunities. Communicate regularly with Hafele colleagues on dealer feedback, product needs, and market trends. Present new product launches and act as knowledgeable resource on Hafele's solutions. Participate in team strategy sessions and contribute ideas for growth and improvement. Assist in developing "customer specific products" What We're Looking for: A professional, proactive team player with strong relationship-building and communication skills. Someone who thrives in a collaborative, solution-oriented environment. A representative of Hafele who acts with integrity and understands the value we bring to the kitchen and bath industry. EDUCATION and/or EXPERIENCE Bachelor's degree from four-year College or University. Considerations will be made for additional training programs or equivalent combination of education and experience. This individual must have a degree of applicable market and product knowledge. Position requires high degree of comfort in dealing with various level of decision-makers. COMPUTER SKILLS Proficiency in MS Excel, Outlook, PowerPoint and Word. Experience with Salesforce is a plus.
    $90k-117k yearly est. 22d ago
  • Job icon imageJob icon image 2

    Looking for a job?

    Let Zippia find it for you.

  • Business Developer

    Gateway Search Associates

    Business advisor job in Mantua, NJ

    Gateway Search has an exciting Business Developer opportunity with a dynamic and growing regional consulting firm that delivers high -impact advisory services to middle -market companies across a range of industries. The firm specializes in strategic, financial, and operational consulting-and is known for building lasting client relationships and driving measurable growth. As they continue to expand, they're looking for a results -driven Business Developer to help lead their growth efforts by identifying new client opportunities, cultivating relationships with C -level decision -makers, and effectively positioning the firm's service offerings. Key Highlights of the Role: Lead strategic outreach and relationship -building with prospective and existing clients Develop and execute a sales plan aligned with growth goals Collaborate with consulting teams to create tailored solutions Represent the firm at industry events and networking functions Leverage CRM tools to manage the sales pipeline and provide insights to leadership RequirementsWhat They're Looking For: 5+ years of experience in business development or consultative B2B sales (professional services preferred) Proven track record working with middle -market clients Strong communication, negotiation, and strategic thinking skills Comfortable working independently and cross -functionally Bachelor's degree required; MBA preferred Benefits Vision, Dental, Medical, Flexible Time Off, 401K Experience Level Mid -Level (5-8 yrs) Base Salary: $85,000-$110,000 Bonus/Commission: $20,000-$40,000 Total Compensation: $105,000-$150,000 Senior (8-12 yrs) Base Salary: $110,000-$140,000 Bonus/Commission $30,000-$60,000 Total Compensation: $140,000-$200,000+
    $140k-200k yearly 60d+ ago
  • Business Coach & Strategist

    SMB Team 3.8company rating

    Business advisor job in Philadelphia, PA

    Are you someone who loves helping people reach their business goals? Are you a great problem solver? If you answered "yes" to these questions, keep reading. The SMB Team is the fastest-growing digital marketing and coaching business for attorneys nationwide and we are looking for a Business Strategist and Advisor to join our Coaching Team! WHAT'S IN IT FOR YOU? 📈 An opportunity to be a part of the #1 Fastest Growing Legal Marketing & Coaching Company in the U.S. 🦷 BENEFITS - We pay for 75% of your Medical, Dental, Vision insurance for YOU and YOUR FAMILY. ☀️ FLEXIBLE VACATION TIME - We encourage you to take time to recharge so you can be your best here at work. 💡 EDUCATION - Team member education and learning budget on courses, events and books. 🌴 FUN - Company activities, outings, and retreats. 💲 INVESTMENTS - 401(k) with a 3% Match. 💻 WORK STYLE - WFH or come to the office. The choice is yours! The salary for this role is $90,000-$95,000 annually. Key Responsibilities: Hold monthly client accountability calls to hold clients accountable to their goals. This may include problem solving, giving advice based on our frameworks, or just listening. Maintain/enforce program standards and frameworks to ensure client success. Execute new program initiatives as they develop. We move quickly and try new things (while maintaining our core systems). If that's not how you like to operate, this probably isn't the role for you. Identify client struggles and offer solutions and services to assist. This could include marketing or virtual assistant services that we offer. Assist with planning and participating in weekly coaching calls and events. This includes weekly group coaching calls, client masterminds when needed, quarterly workshops, and one-off workshops. Requirements 5 - 7 years experience as a successful business coach, with experience holding clients accountable, overseeing a budget, goal setting, KPI tracking, and a history of business growth. A Coaching Accreditation is required. Familiarity with EOS/Traction and/or Scaling-Up strongly preferred. Excellent written and verbal communication skills. We don't expect you to be the next great novelist or public speaker, but we do expect you to be able to effectively communicate information that may not be familiar to our clients. MUST have strong interpersonal skills. We are looking for individuals who can build great relationships with our clients. Proficient with the Google Suite. Solid organization skills so that you can effectively manage your daily, weekly, and monthly to-do list. Ability to thrive in a fast-paced environment and think quickly on your feet in order to adapt to client situations or changes in the company. Proactive and resourceful in all aspects of your role. Coachable Attitude: Must possess the ability to be coached and open to feedback, demonstrating a commitment to personal and professional growth. Collaborative & Adaptable Mindset: Must be a team player who can set aside ego to work effectively with colleagues and clients. Quick Learner: Ability to rapidly grasp new processes and adapt to a fast-paced, innovative environment. Initiative: Willingness to take initiative on tasks, regardless of size, both within the department and for clients. Process Improvement: Eagerness to participate in and collaborate on enhancing internal processes for greater efficiency and effectiveness. Budget Management Experience: Must have managed a budget of at least $2.5M Reading Requirements: If not already familiar with these books, the employee must read them within the first month of employment. Must have read and be familiar with the following books: Scaling Up by Verne Harnish The E-Myth Revisited by Michael E. Gerber Traction by Gino Wickman Good to Great by Jim Collins Law Firm Growth Accelerator by Bill Hauser and Andy Stickel Benefits SMB Team is a rapidly-growing marketing agency and coaching business for lawyers. After four years of 300% year-over-year growth, we have quickly become one of the top brands in the legal industry. Bottom Line: We change lives. Want proof? Read our Google My Business reviews. The SMB Team is an Equal Opportunity Employer. The policy of The SMB Team is to extend opportunities to qualified applicants and employees on an equal basis regardless of an individual's race, color, gender, age, national origin, religion, citizenship status, marital status, sexual orientation, gender identity, transgender status, physical or mental disability, protected veteran status, genetic information, pregnancy, or any other categories protected by applicable federal, state or local laws. The SMB Team is an Equal Opportunity Employer - Minority/Female/Disabled/Protected Veterans
    $90k-95k yearly Auto-Apply 60d+ ago
  • Experienced Spa Business Developer

    Elders Choice

    Business advisor job in Willow Grove, PA

    Job details Salary$25 - $75 an hour ( Based in experience) Job TypePart-time/ Full-time ContractQualifications Master's (Preferred) Business development: 5 years (Preferred) Sales: 5 years (Preferred) Benefits ( Discussed) Full Job Description About the Position Currently seeking a motivated and ambitious who is passionate about creating personable experiences and life-long memories. Responsibilities Hires, trains, supervises, develops, and terminates the employment of those supervised in accordance with company polices and directives Performs timely performance evaluations on Associates. Compiles comprehensive reports regarding performance of Associates. Responsible for implementation of all laws, regulations and policies regarding, employment practices, safety rules and all other company policies and procedures Oversee day-to-day center operations run smoothly and efficiently through a visible management presence and leadership. Process, review and submit payroll for all Spa staff Manage retail and supply inventory through monthly audits and loss control measures, and ensuring all supplies are adequately stocked Daily walk-throughs of center to ensure staff is maintaining a clean, organized and safe facility Manage financial performance of the center through achievement of sales and revenue targets, expense management, proper planning and forecasting, and retention Track, report and analyze the details of financial operation Prepare and implement action plans to meet or exceed monthly financial goals Assist club management in development of annual operating and capital budgets, as well as long term growth strategy Review applicable financial statements and reports Effectively and professionally interacts and communicates with senior management, managers, other Associates, vendors, members, senior staff, and guests. Promote harmonious relations among members, staff, vendors, and the community at-large. Communicate timely and follow up, as appropriate. Active participation in required events, required programs, required meetings and required trainings. Promote the company's safety goals and actively work towards ensuring a safe working environment. Interpret and ensure compliance with company policies and procedures. Actively further Spa objectives and continuously support improvement and positive change, which includes participating on corporate designated committees to improve the company and business operations. Make professional development a consistent priority. Act as club and/or regional Manager on Duty, as required Qualifications Minimum of 5 years prior spa management experience Demonstrated ability to support and develop diverse environment At least 2 years experience in personnel supervision, training, and evaluation Flexibility in work schedule, as job may require day and evening shifts, weekends and holidays Physical Requirements This position deals with outside personnel such as members and clients on a regular basis with contact in various forms such as in person, phone and email. The location of the position changes frequently from indoors to outdoors as site visits are necessary. However, extreme environmental conditions do not exist. It is sometimes necessary to deal with unpleasant or angry people with the need to problem solve difficult situations. It is necessary to adapt to a frequently changing environment. Sitting and standing is as needed. It is necessary for the position to travel independently to property locations on a regular basis. Lift, push and pull up to 30 lbs. Job Types: Part-time, Contract Pay: $25.00 - $75.00 per hour Schedule: 8 hour shift Ability to commute/relocate: South Hampton Pa, 18966: Reliably commute or planning to relocate before starting work (Preferred) Education: Master's (Preferred) Experience: Business development: 5 years (Preferred) Sales: 5 years (Preferred) Willingness to travel: 25% (Preferred) Work Location: One location Hiring Insights Hiring 1 candidate for this role Compensation: $25.00 - $75.00 per hour
    $25-75 hourly Auto-Apply 60d+ ago
  • Business Insights Specialist (US)

    TDI 4.1company rating

    Business advisor job in Mount Laurel, NJ

    Hours: 40 Pay Details: $92,220 - $149,310 USD TD is committed to providing fair and equitable compensation opportunities to all colleagues. Growth opportunities and skill development are defining features of the colleague experience at TD. Our compensation policies and practices have been designed to allow colleagues to progress through the salary range over time as they progress in their role. The base pay actually offered may vary based upon the candidate's skills and experience, job-related knowledge, geographic location, and other specific business and organizational needs. As a candidate, you are encouraged to ask compensation related questions and have an open dialogue with your recruiter who can provide you more specific details for this role. Line of Business: Analytics, Insights, & Artificial Intelligence : The Business Insights Specialist is responsible for conducting analyses on curated and/or aggregated DataMart's in conjunction with deep business subject matter expertise, to generate relevant analytical insights for business issues and identify opportunities to drive business growth and value. This role works in partnership with business leaders to present or generate appropriate insights including the delivery of supporting collateral and/or presentations. Job Description Depth & Scope: Works autonomously and accountable for acting as a lead within a specialized business management function and may provide work direction to others Provides seasoned specialized knowledge, advice and/or guidance to various stakeholders and team members Scope of role may have enterprise impact Focuses on short to medium - term issues (e.g. 6-12 months) Undertakes and completes a variety of complex projects and initiatives requiring specialist knowledge and/or the integration of cross functional processes within own area of expertise Oversees and/or independently performs tasks from end-to-end May interact with any hierarchy level up to executive leaders and external vendors Education & Experience: Undergraduate degree or advanced technical degree preferred (e.g., math, physics, engineering, finance or computer science) Graduate's degree preferred with either progressive project work experience, or; 5+ year of relevant experience; higher degree education and research tenure can be counted Preferred Skills: Experience with PowerBI or Tableau Data Analytics & Technology Skills Ability to prioritize and work in a fast-paced environment Relevant Audit experience is a plus, but not required Customer Accountabilities: Leads on the interpretation of complex business issues, generates multifaceted insights and identifies opportunities to help drive business growth or address business/enterprise needs Presents and communicates generated insights and recommended business actions to stakeholders/business leaders in an easily digestible manner, leveraging tools/techniques/methods to produce a variety of visualizations/presentations that fit the audience Acts as the primary interface with business to bridge and translate business requirements to analytics and reporting needs for a given domain/business Applies collaborative and strong stakeholder management approach to constructively influence and persuade stakeholders and partners where appropriate Serves as an authority on a given business domain and provides business expertise to place context around analytics discovery and inform recommendations Escalates data/process related problems and communicates to relevant teams in a timely manner and makes recommendations for resolution Provides day-to-day support and delivery of analytics Shareholder Accountabilities: Represents functional area as a business insights & analytics specialized expert Synthesizes complex and vast amount of information and translates into actionable insights and strategy Builds business requirements and facilitates project execution to develop insights Collaborates with partners on business challenges and delivers fact-based analytical advice that aligns to strategy and drives shareholder value Identifies opportunities for business growth within a specific business or function by identifying potential use cases and value drivers Utilizes both quantitative and qualitative methodologies to interpret and present data effectively and clearly Works directly with the business teams to gather the demand for analytics and work with the analytics hub to fulfill the analytics demand Provides business explanation for anomalies/outliers identified during analysis Works with business functions and analytics teams to transition business requirements to analytics requirements Trains business users on how to integrate analytics into decisions Leverages knowledge of data capabilities to build and deliver insights Develops analysis to corroborate initial proof of concept Executes on data requests accurately and within a timely manner Identifies and investigates data/analytics related issues Ensures business operations are in compliance with applicable internal and external requirements (e.g. financial controls, segregation of duties, transaction approvals and physical control of assets) Leads/facilitates and/or implements action/remediation plans to address performance/risk/governance issues Actively manages relationships within and across various business lines, corporate and/or control functions and ensures alignment with enterprise and/or regulatory requirements Keeps abreast of emerging issues, trends, and evolving regulatory requirements and assesses potential impacts Maintains a culture of risk management and control, supported by effective processes in alignment with risk appetite Employee/Team Accountabilities: Participates fully as a member of the team, supports a positive work environment that promotes service to the business, quality, innovation and teamwork and ensures timely communication of issues/points of interest Provides thought leadership and/or industry knowledge for own area of expertise in own area and participates in knowledge transfer within the team and business unit Keeps current on emerging trends/developments and grows knowledge of the business, related tools and techniques Participates in personal performance management and development activities, including cross training within own team Keeps others informed and up to date about the status/progress of projects and/or all relevant or useful information related to day-to-day activities Contributes to team development of skills and capabilities through mentorship of others, by sharing knowledge and experiences and leveraging best practices Leads, motivates and develops relationships with internal and external business partners/stakeholders to develop productive working relationships Contributes to a fair, positive and equitable environment that supports a diverse workforce Acts as a brand ambassador for your business area/function and the bank, both internally and/or externally Contribute to data deliverables including Internal, Senior Management, and Audit Committee Reporting Apply automation and innovation on data platforms to support business function Design and implement complex business data information management frameworks to provide a solution that meets business requirements Understand business data and provide analysis and requirements to ensure the data design / development initiatives are in line with the planned design and standards Conduct meaningful analysis at the functional or enterprise level using results to draw conclusions, make recommendations, assess the effectiveness of programs/ policies/ practices. Implement continuous process / performance improvements where opportunities exist. #LI-AMCBCorporate #IN-AMCBCorporate Who We Are: TD is one of the world's leading global financial institutions and is the fifth largest bank in North America by branches/stores. Every day, we deliver legendary customer experiences to over 27 million households and businesses in Canada, the United States and around the world. More than 95,000 TD colleagues bring their skills, talent, and creativity to the Bank, those we serve, and the economies we support. We are guided by our vision to Be the Better Bank and our purpose to enrich the lives of our customers, communities and colleagues. TD is deeply committed to being a leader in customer experience, that is why we believe that all colleagues, no matter where they work, are customer facing. As we build our business and deliver on our strategy, we are innovating to enhance the customer experience and build capabilities to shape the future of banking. Whether you've got years of banking experience or are just starting your career in financial services, we can help you realize your potential. Through regular leadership and development conversations to mentorship and training programs, we're here to support you towards your goals. As an organization, we keep growing - and so will you. Our Total Rewards Package Our Total Rewards package reflects the investments we make in our colleagues to help them and their families achieve their financial, physical and mental well-being goals. Total Rewards at TD includes base salary and variable compensation/incentive awards (e.g., eligibility for cash and/or equity incentive awards, generally through participation in an incentive plan) and several other key plans such as health and well-being benefits, savings and retirement programs, paid time off (including Vacation PTO, Flex PTO, and Holiday PTO), banking benefits and discounts, career development, and reward and recognition. Learn more Additional Information: We're delighted that you're considering building a career with TD. Through regular development conversations, training programs, and a competitive benefits plan, we're committed to providing the support our colleagues need to thrive both at work and at home. Colleague Development If you're interested in a specific career path or are looking to build certain skills, we want to help you succeed. You'll have regular career, development, and performance conversations with your manager, as well as access to an online learning platform and a variety of mentoring programs to help you unlock future opportunities. Whether you have a passion for helping customers and want to expand your experience, or you want to coach and inspire your colleagues, there are many different career paths within our organization at TD - and we're committed to helping you identify opportunities that support your goals. Training & Onboarding We will provide training and onboarding sessions to ensure that you've got everything you need to succeed in your new role. Interview Process We'll reach out to candidates of interest to schedule an interview. We do our best to communicate outcomes to all applicants by email or phone call. Accommodation TD Bank is an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, age, disability, status as a protected veteran or any other characteristic protected under applicable federal, state, or local law. If you are an applicant with a disability and need accommodations to complete the application process, please email TD Bank US Workplace Accommodations Program at ***************. Include your full name, best way to reach you and the accommodation needed to assist you with the applicant process.
    $92.2k-149.3k yearly Auto-Apply 21d ago
  • Automotive Business Consultant - Accounting Specialist

    Reynolds and Reynolds Company 4.3company rating

    Business advisor job in Philadelphia, PA

    . Must be willing to travel, with overnight hotel stays, up to 5 nights per week (every week). Reynolds and Reynolds is looking for experienced automotive professionals to join our consulting team. Our superior software solutions, our award-winning sales, service, and support have made us one of the most recognized and respected companies in the automotive industry. As an Automotive Business Consultant your primary focus will be to establish professional relationships with customers and help their businesses become more efficient, effective, and profitable. You will work with dealership personnel to identify trouble areas within the dealership and then use established and proven consulting services programs, as well as your industry knowledge, to help solve these issues. Once a project is complete, you will follow-up with customers to maintain relationships and provide ongoing 'fee for service' support and problem resolution. By helping these customers become successful in the different areas of the dealership, you will build trust that will further drive consulting services sales. If you are looking for an opportunity to utilize your automotive skills and make a difference for automotive dealerships across the country, please apply today!","job_category":"Consulting","job_state":"PA","job_title":"Automotive Business Consultant - Accounting Specialist","date":"2026-01-04","zip":"19019","position_type":"Full-Time","salary_max":"80,000. 00","salary_min":"60,000. 00","requirements":"High School Diploma or equivalent; Bachelor's preferred but not required~^~5+ years of automotive dealership experience (Office Manager, controller(automotive accounting), and AP\/AR Accounting Representative)~^~Must be willing to travel extensively with overnight hotel stays up to 5 nights per week (every week). ~^~Must have reliable transportation as well as a valid driver's license, with fewer than 2 moving violations in the last three years and no OVI\/DUI\/DWI violations in the last five years. ~^~Must have reliable home internet with sufficient bandwidth for video conferencing~^~Experience with Reynolds and Reynolds accounting software is highly preferred","training":"Our training consists of time with experienced consulting and sales representatives in the field for approximately 90 days, online courses completed in your home office, and classroom instruction through our offices in Dayton and Houston. Your compensation during training will be a $60,000-63,000 base salary. You will be eligible for quarterly bonuses after the 9 month training period. Total targeted income after training (including base and bonuses) is $80,000+. ","benefits":"We strive to offer an environment that provides our associates with the right balance between work and family. We offer a comprehensive benefits package including: - Medical, dental, vision, life insurance, and a health savings account - 401(k) with up to 6% matching - Paid vacation and sick days - Eight paid holidays - Referral bonuses - Professional development and training - Promotion from within Reynolds and Reynolds promotes a healthy lifestyle by providing a non-smoking environment. Reynolds and Reynolds is an equal opportunity employer. ","
    $60k-63k yearly 19d ago
  • Microsoft Business Applications Sales Consultant

    Itc Worldwide 4.7company rating

    Business advisor job in Cherry Hill, NJ

    ITC WORLDWIDE is seeking a dynamic and experienced Microsoft Business Applications Senior Sales Consultant WFH or an ITC field office Are you passionate about selling business applications solutions that empower organizations to achieve more? Do you have a proven track record of delivering results in a complex and competitive market? Do you have experience with Microsoft Dynamics 365 Finance & Operations or other ERP systems? If so, we want to hear from you. To be successful in this position you will possess the following attributes: Motivated and proactive professional with previous experience in end-to-end sales within Microsoft or equivalent Enterprise Applications. 5+ years face-to-face selling experience - Microsoft product suite expertise including D365, PowerApps and Business Central is highly regarded. Demonstrated ability to hunt new business opportunities. Ability to build and foster strong customer relationships in existing customer base. A strong customer-centric approach and ability to network across a complex organization. Skills in managing multiple commercial processes (new business sales), forecasting precisely and identifying challenges to positive commercial outcomes. Develop and execute a sales strategy in designated territories and work with both vendor and Industry teams to execute. Arrange and conduct customer meetings, serve as trusted advisor by understanding a customer's existing and future digital transformation roadmap and driving the sales. Strong networking skills and industry experience Ability to drive new business and get engaged with lead generation. Liaising with solution consultants to drive correct business outcomes. Desire to be involved in a rapidly growing business and take a leadership role in helping it thrive. Strong personality motivated by continual improvement and self-development Responsibilities: Develop and execute sales strategies to grow revenue and market share in the Finance & Operations segment. Build and maintain strong relationships with key decision makers and influencers across various industries and geographies. Understand customer needs and pain points and propose value-added solutions that leverage Microsoft's D365 platforms and applications. Collaborate with delivery and pre-sales teams to ensure proposed solutions align with client requirements. Working with Marketing and Business Development personnel to help develop lead generation campaigns along with target marketing to specific verticals. · Manage the entire sales cycle, including prospecting, negotiations, and contracting Develop and nurture a robust pipeline of prospects to achieve and exceed sales targets Leverage your sales knowledge and existing Microsoft ecosystem network Qualifications: Minimum of 5 years of experience in selling enterprise software solutions, preferably in the ERP domain Strong knowledge of Microsoft Dynamics 365 Finance & Operations or other ERP systems and their business benefits Excellent communication, presentation, and negotiation skills Ability to work independently and as part of a team in a fast-paced and dynamic environment. Bachelor's degree in business, finance, or related field Prior consulting services sales experience required, and an understanding of Microsoft's Business Applications preferred (Sales, Service, Marketing, Finance, HR, Supply Chain, and Project Operations) Package Details Contract W2 role for an experienced Tech Seller! Base Salary (Draw) W2 Commissioned: from 1-3% on lifetime Support + Bonus on Managed Services +Cash Bonus What's in it for you Qualified Leads Technical Sales & Service Support Product Selling Training Provided Dynamics 365 - CRM Dynamics 365 - Business Central Microsoft 365 ISV Solutions (Offers) Neural Impact Sales Optimization Training Differentiation & Engagement Effective Discovery & CIO Engagement Project Impact & Objection Handling $ 150,000.00 (US Dollar) BIzzApp Sales 2. Acct exec 3. services & support consult
    $150k yearly 60d+ ago
  • Sr. Business Consultant - Outside Sales

    Alcott HR 3.4company rating

    Business advisor job in Philadelphia, PA

    Job Description Alcott HR is seeking an experienced Outside Sales professional to join our team as a Senior Business Consultant. As a Professional Employer Organization, we offer comprehensive Human Resources support to our clients. In this role, you will spearhead the launch of our services in the Philadelphia market, serving as the primary sales representative. Your main responsibilities will include identifying potential business opportunities, fostering strong relationships throughout the area, and engaging with potential clients to understand their needs. You will work closely with business owners and key decision-makers to provide tailored HR solutions. We've got a lot to offer: Uncapped commission and unlimited territory Ability to sell any of our offerings to any industry (PEO, ASO, HRO, HR Consulting) Competitive base salary plus an industry-leading commission plan with escalating rates Remote schedule Here's what you'll do: Develop and maintain relationships with business owners and key decision makers. Leverage your professional network to generate referral business and expand Alcott HR's client base Network with business advisors to educate them on Alcott HR's offerings and benefits for their clients Prospect and network for business owners and key decision makers to explain how Alcott HR can help their company to grow Complete required sales process, paperwork and finalize new client contracts Travel throughout our open territory. No set territories with Alcott HR! Exceed sales goals determined by management, and reach your maximum earning potential You are someone who has: 2+ years of business-to-business sales experience with a focus on relationship-building Successful and stable track record of excellence Ability to aggressively prospect for new business A positive and consultative mindset when engaging with clients Exceptional verbal and written communication abilities, particularly with C-level executives Ability to work independently, as well as being a collaborative team member Expertise in consultative and solution-oriented sales techniques A driven, self-starter attitude with strong time management skills We definitely want to talk to you if you have the following: Demonstrated ability in cold calling and prospecting with a positive and persistent style Proven ability to be a "hunter gatherer" within the C-level market PEO and/or Employee Benefit sales experience We know you have your choice of roles for your next opportunity. Here's why we think you should choose Alcott HR: You'll be joining a PEO & HR company that is poised for rapid growth, taking a new and exciting service model and message to underserved markets across the US. We have a big market to go after, striving to provide the best and most unique HR service in the space, and some of the most loyal and enthusiastic clients behind us. Big Enough to Get the Job Done, Small Enough to Care. Family working environment with the ability to influence executive decision making and help steer the ship. Compensation: Base Salary of $70,000-$85,000 plus commission structure, enabling a potential total earning potential of $105,000-$185,000+ About Alcott HR At Alcott HR, we have a Passion for People and Performance™. We empower leaders to focus on their core business purposes and meaning which enables them to more quickly and efficiently grow their business. Alcott HR provides clients and business owners with customized solutions for running their business, including HR best practices, regulatory compliance, payroll, training and development, employee benefits, risk management support, workers' compensation insurance and employment related administration. We serve a diverse group of successful profit and not for profit businesses across the U.S. Get to know us by visiting ***************** Alcott HR provides equal employment opportunities (EEO) to all employees and applicants for employment without regard to race, color, religion, sex, national origin, age, disability or genetics. In addition to federal law requirements, Alcott HR complies with applicable state and local laws governing nondiscrimination in employment in every location in which the company has facilities.
    $105k-185k yearly 21d ago
  • Business Development

    Quaker Mechanical

    Business advisor job in Riverton, NJ

    Job DescriptionBusiness Development - Commercial HVAC (Union Market) Company: Quaker Mechanical Employment Type: Independent Contractor (1099) - Commission OnlyAbout Us Quaker Mechanical is a leading commercial HVAC contractor specializing in union projects. With a reputation for excellence, we deliver top-tier mechanical solutions in the union HVAC marketplace across the Cinnaminson area and beyond. Position Overview We're seeking a driven Business Development professional with a solid background in commercial construction sales within the union HVAC market. This is a 1099, commission- only opportunity designed for self-starting individuals eager to grow their income based on performance. Key Responsibilities Cultivate and maintain relationships with general contractors, developers, and union contacts. Identify and pursue new project opportunities in commercial HVAC. Negotiate and close deals aligned with company capacity and goals. Collaborate with internal teams (estimating, operations) to transition new projects smoothly. Provide market insights and strategic growth recommendations. Qualifications 2+ years of experience in commercial construction sales, with a focus on union HVAC. Familiarity with the union HVAC landscape and strong industry contacts. Excellent negotiation, communication, and relationship-building skills. Ability to work independently in a commission-based, 1099 role. Compensation Structure (Commission + Stipends) This role offers uncapped earning potential through a tiered commission on gross profit, plus fixed monthly stipends: 0.5% on $0 - $100,000 Contract amount 1.0% on $101,000 - $500,000 Contract amount 1.5% on $501,000 - $750,000 Contract amount 2.0% on $751,000 and above Contract amount $100/month cell phone stipend $300/month auto stipend
    $76k-120k yearly est. 15d ago
  • Business Developer - Landscape Construction

    Brightview 4.5company rating

    Business advisor job in Norristown, PA

    **The Best Teams are Created and Maintained Here.** + The Maintenance Installation Business Developer is responsible for driving new business growth by identifying, pursuing, and securing contracts for small scale landscape construction services and installation projects. This role requires a strong balance of sales expertise, industry knowledge, and relationship management to expand the client base, increase revenue, and ensure long-term customer satisfaction. **Key Responsibilities:** + Generate new business opportunities through prospecting, networking, referrals, and cold outreach + Build and maintain a healthy pipeline of opportunities for installation projects outside the Maintenance book of business. + Develop customized proposals and sales presentations that address client needs and highlight company value + Negotiate and close contracts in alignment with company pricing standards and profitability goals + Build strong, long-term relationships with property managers, developers, general contractors, and decision-makers + Serve as the primary point of contact during the sales cycle and ensure a smooth transition to operations teams post-sale + Conduct regular follow-ups to ensure client satisfaction, identify upsell opportunities, and drive retention + Stay informed on local market conditions, competitor activity, and industry trends to identify new opportunities + Represent the company at trade associations, networking events, and community engagements. + Leverage market intelligence to position the company as a preferred partner for landscaping installation solutions + Partner with estimating, operations, and project management teams to ensure accurate proposals and service delivery. Review large scale ($1M or greater) jobs with senior leadership (SVP) + Work with branch and senior leadership to set annual sales goals, budgets, and strategies + Maintain accurate records of sales activities, pipeline development, and results using CRM systems **Education and Experience:** + Bachelor's degree in business, Horticulture, Landscape Architecture, or related field preferred (or equivalent work experience) + 3-5 years of proven success in B2B sales preferably in landscaping, construction, property management, facility management or related service industries + Knowledge of landscape maintenance and installation practices, horticulture, and project management fundamentals + Strong sales, negotiation, and presentation skills + Self-motivated, results-driven, and comfortable working independently + Proficiency with CRM tools, Microsoft Office Suite, and sales reporting **Physical Demands/Requirements:** + Regular local travel to client sites, industry events, and networking opportunities + Office-based activities including proposal development, client follow-up, and team collaboration + Ability to physically perform the basic life operational functions of walking, standing, and kneeling + Valid driver's license with a clean driving record **Work Environment:** + Works in an indoor office and outdoors during construction site walks or project evaluations + Requires occasional evening and/or weekend networking events or meetings **_BrightView Landscapes, LLC is an Equal Opportunity and E-Verify Employer._** **_This job description is subject to change at any time._** **_BrightView offers a suite or health, wellness, and financial benefits to full-time team members. Benefits offerings for full-time team members include medical, dental, and vision insurance, ancillary and voluntary products, a 401k savings plan with employer contributions, and 6 to 9 company paid holidays per year. Employees may also be eligible to receive paid time off for vacation and/or sick leave, tuition reimbursement, and/or potential variable pay opportunities based on position and performance. A detailed benefits package will be provided during the interview process_** _._ _It's Not Just a Team. It's One BrightView._
    $89k-137k yearly est. 57d ago
  • Landscape Business Development - South Jersey

    Gras Lawn

    Business advisor job in Beverly, NJ

    Job DescriptionSalary: Gras Lawn, a commercial landscape company, is seeking an experienced Landscape Business Developer for the South Jersey Market. Your main responsibility is developing business with potential new customers, building and maintaining trusted relationships with key decision-makers, understanding their challenges, and creating value solutions. Your role also involves effectively identifying opportunities, gathering valuable intelligence, creating customer-centric proposals, collaborating with team members, meeting specific activity targets, and closing deals. The Business Developer focuses on strengthening Gras Lawns market presence and driving profitable growth. This position plays a key role in meeting long-term strategic objectives by fostering important customer relationships, identifying business opportunities, negotiating and closing deals, and maintaining a comprehensive understanding of the current market landscape. Identifyandunderstandthechallengesofprospectiveclientsanddevelopsolutions. Provideaccurateforecastsforsales,deliverables,andkeyperformanceindicators(KPIs). Achievesalesgoalswhilehavingtheabilitytoworkindependently. Usesalestechniquestofindnewcustomersandbuildlong-termbusinessrelationships.Also,focusonmarketingandpricingstrategies. Conductphoneprospecting,salespresentations,virtualdemonstrations,andcontractnegotiationswithminimalsupervision. Identifycustomerneedsandapplysolution-basedsellingtechniquestodemonstratethevalueof GrasLawnsserviceseffectively. Buildandnurturerelationshipswithpotentialandcurrentclients. Planyourdailyactivitiesandaimtomeetspecificperformancebenchmarkstoclosebusinessdealssuccessfully. ConsistentlyandreliablylogactivitiesintheCRM. Workeffectivelyinafast-pacedenvironmentwhilemaintainingastrongsenseofurgency. Communicateproactivelywithallclients,prospects,andcolleagues. SkillsRequired: ExtensiveexperienceintheCommercialLandscapeIndustry Proventrackrecordofsalesgoalattainmentandpipelinemanagement 3-5yearsofexperienceinB2Bsalesatmid-to-seniorlevels. Localknowledgeandcontactsinoneormoremarketsegments Proficientwithcomputerprograms,including AspireandaCRMtool Highlycompetitive,positive,andresults-driven Exceptionalmultitasker. Excellentoralandwrittencommunicationabilities,strongpresentationskills,andprofessionalexperiencewithsocialmedia. Passionate,organized,andresourcefulindividualwithoutstandinglisteningandinterpersonalskills. Highly organized, self-motivated, and hardworking, with effective time management capabilities. Easilyadaptabletonewsituations. Salary commensurate with experience. Youwillberesponsiblefor: TheBusinessDeveloperoverseesthesalespipelinefromtheprospectingstagetoclosingandisaccountablefortheentiresalescycle,includingsnowsalesincertainregions.Additionally,the BusinessDeveloperworksincollaborationwithpartnersacrossoperations,finance,marketing,andotherdepartmentstoeffectivelyrespondtobidsandachievesalesgoals. Salary commensurate with experience.
    $76k-120k yearly est. 20d ago
  • Business Office Accounting Intern, part-time

    The Hun School of Princeton 4.1company rating

    Business advisor job in Princeton, NJ

    Part-time Description The Hun School of Princeton seeks a Business Office Accounting Intern to assist with daily accounting activities, correspondence, organization, and general business office tasks. The accounting intern can expect to learn and participate in financial data preparation, create, maintain and track data in various software programs, assist with the advancement of the accounting system, basic general ledger functions, billing, and other general accounting activities. This position reports to the Controller, is part time, (paid) non-exempt, and will work five (5) days per week (Monday through Friday) and five (5) hours per day; hours worked can be flexible within the School's business hours (8am to 4pm) for a total of twenty-five (25) hours per week. Responsibilities and Essential functions: Shadow members of the business office as they perform their duties; Learn the accounting basics of working as a part of the business office team to compile and analyze data, track information and support the School community; Assist with research, data entry, recording, tracking, and maintenance of accurate account documentation and financial records; Identify, research and resolve discrepancies and issues; Prepare monthly reconciliations of general ledger balances for analysis; Develop and execute correspondence for billing, collections and other accounting activities requiring a high volume of (verbal and written) contact; Maintain excel spreadsheets to provide detail reporting and follow up related to accounting system; Work to understand the mapping of reports in the system to provide needed information to all departments for actual and budget reporting; Back up front desk staff to cover vacations/sick time; Perform tasks which are supportive in nature to the essential functions of the job, which may be altered or redesigned as necessary. Requirements Recent graduate or actively working towards a degree in accounting or relevant degree; Strong understanding of accounting and financial principles; Excellent technology skills including Microsoft Office suite, advanced Excel skills, and Google Mail (Gmail) applications are required; Detail oriented as well as thorough and accurate; Must possess good judgment, tact, sensitivity, and discretion with confidential information, materials and situations; Comfortable working in a fast paced and dynamic school atmosphere; Collaboration and teamwork skills; Good social skills and the ability to interact and work within a diverse community including co-workers, staff, faculty, students, alumni and parents; Must be fingerprinted and pass the State of New Jersey criminal background check. Hourly Rate Range: $22.50 to $25 per hour Eligible employees receive a robust benefits package that includes health, dental, vision, and prescription insurance coverage, retirement plan options with a school matching program, life and disability insurance, opportunities for professional development, and a variety of other valuable programs and benefits designed to enhance employee well-being. The Hun School of Princeton is an E-Verify employer. Information regarding E-Verify can be found here: E-Verify.gov. To Apply: The Hun School of Princeton Employment Application ABOUT THE HUN SCHOOL The Hun School of Princeton is a co-educational, private day and boarding school in Princeton, New Jersey. Individual attention and strong student-faculty relationships are the hallmarks of the School. On the 50-acre campus between Philadelphia and New York City, student-centered, hands-on learning prepares students for the global community in which they will live and work. The Hun School is comprised of nearly 700 students in its Middle School, Upper School, and Postgraduate Program. Our campus is home to students from twenty-two countries and fifteen states. Our campus is located in historic Princeton, New Jersey, a short train ride away from both New York City (50 miles) and Philadelphia (45 miles). Home to Princeton University, The Institute for Advanced Study, Princeton Theological Seminary, and an array of cultural centers and organizations, Princeton is regarded as one of the most academically-minded communities in the world. Often named one of the country's best places to live, Princeton is a friendly, multicultural community surrounded by mountains, parks, and lakes. There are award-winning museums and theatres, celebrated public and private schools, destination restaurants and hotels, and a robust calendar of community events to enjoy. Our mission: The Hun School of Princeton empowers each student to thrive in a diverse and ever-changing world, by nurturing resilient character, providing individual mentorship, and inspiring vigorous and joyful learning. Our community: In our mission of educating global citizens with resilient character, we actively seek candidates who can bring a diversity of experiences and perspectives to our community. The Hun School of Princeton is an equal opportunity employer and does not discriminate in employment opportunities or practices on the basis of race, color, religion, sex, sexual orientation, national origin, age, disability, or any other characteristics or activity protected by law. The Hun School of Princeton is an E-Verify employer. Information regarding E-Verify can be found here: E-Verify.gov.
    $22.5-25 hourly 60d+ ago
  • Business Development - Light Industrial Temporary Staffing

    Master Search Solutions

    Business advisor job in Philadelphia, PA

    Our client, a growing, privately owned, Light Industrial Staffing services, in New jersey is looking for a Business Development professional to join their team. This role will focus on bringing in new Light Industrial business in the Southern, NJ, Philly, and Northern Delaware market. Most of this position is field based and Friday's are spent in their Southern New Jersey office Responsibilities include; Prospecting new business by phone, email, social media, and in-person Meeting new clients within an assigned territory (with no internal competition) nts. Using Salesforce to document sales activity, meetings, follow ups etc. Contract negotiations. Reach agreed upon monthly sales targets. YOU might be the right person if YOU have: Previous light industrial temporary staffing sales experience or recruiting experience. Outside B2B sales experience selling into the light industrial space Strong closing abilities. Strong sense or urgency Attention to detail. Our client offers a competitive base salary, commission, car allowance, phone and benefits Master Search Solutions is a direct hire recruiting firm that specializes in the New Jersey marketplace. We have nearly 30 years of experience connecting top talent with leading businesses. We are committed to (and celebrate) diversity, equity, and inclusion.
    $84k-133k yearly est. 60d+ ago
  • Business Development

    Coretitle

    Business advisor job in Philadelphia, PA

    CORE is currently seeking a hardworking and experienced Title Insurance Sales Representative. Join one of Philadelphia's fastest growing title companies and most successful title team! Whether you have a well-established client base or need help taking your business to the next level, we want to meet. Increase overall resale and refinance market share in the New Jersey and Pennsylvania market by building strong relationships with REALTORS, mortgage brokers and loan originators, banks, credit unions. Team player who acts as the liaison between the inside office staff and clients in the field. Must be confident in making cold calls, prospecting for leads, as well as maintaining current customer's needs. Strong social media presence is a plus. Develop and initiate new sales and marketing ideas. Actively pursue office presentations with office brokers and staff Knowledge of real estate business is extremely helpful. Consistently increase business and revenues Candidate must possess the following: Strong work ethic. Must provide own reliable transportation. Superior time management skills OTHER REQUIREMENTS: Attending outside functions both during the day and some evenings Excellent interpersonal communication skills (both written and verbal) Ability to effectively present information one-on-one and in group settings Maintain a professional appearance and providing a positive company image EDUCATION: Minimum High School or equivalent (required) Degree in Sales and Marketing (preferred) EXPERIENCE: 2-5 years of successful sales experience in the Real Estate industry Salary is commensurate with experience Job Type: Full-time
    $84k-133k yearly est. 60d+ ago
  • Business Insights Specialist (US)

    TD Bank 4.5company rating

    Business advisor job in Mount Laurel, NJ

    Hours: 40 Pay Details: $95,264 - $155,376 USD TD is committed to providing fair and equitable compensation opportunities to all colleagues. Growth opportunities and skill development are defining features of the colleague experience at TD. Our compensation policies and practices have been designed to allow colleagues to progress through the salary range over time as they progress in their role. The base pay actually offered may vary based upon the candidate's skills and experience, job-related knowledge, geographic location, and other specific business and organizational needs. As a candidate, you are encouraged to ask compensation related questions and have an open dialogue with your recruiter who can provide you more specific details for this role. Line of Business: Analytics, Insights, & Artificial Intelligence Job Description: Job Summary: The Business Insights Specialist is responsible for conducting analyses on curated and/or aggregated DataMart's in conjunction with deep business subject matter expertise, to generate relevant analytical insights for business issues and identify opportunities to drive business growth and value. This role works in partnership with business leaders to present or generate appropriate insights including the delivery of supporting collateral and/or presentations. Depth & Scope: Works autonomously and accountable for acting as a lead within a specialized business management function and may provide work direction to others Provides seasoned specialized knowledge, advice and/or guidance to various stakeholders and team members Scope of role may have enterprise impact Focuses on short to medium - term issues (e.g. 6-12 months) Undertakes and completes a variety of complex projects and initiatives requiring specialist knowledge and/or the integration of cross functional processes within own area of expertise Oversees and/or independently performs tasks from end-to-end May interact with any hierarchy level up to executive leaders and external vendors Education & Experience: Undergraduate degree or advanced technical degree preferred (e.g., math, physics, engineering, finance or computer science) Graduate's degree preferred with either progressive project work experience, or; 5+ year of relevant experience; higher degree education and research tenure can be counted Customer Accountabilities: Leads on the interpretation of complex business issues, generates multifaceted insights and identifies opportunities to help drive business growth or address business/enterprise needs Presents and communicates generated insights and recommended business actions to stakeholders/business leaders in an easily digestible manner, leveraging tools/techniques/methods to produce a variety of visualizations/presentations that fit the audience Acts as the primary interface with business to bridge and translate business requirements to analytics and reporting needs for a given domain/business Applies collaborative and strong stakeholder management approach to constructively influence and persuade stakeholders and partners where appropriate Serves as an authority on a given business domain and provides business expertise to place context around analytics discovery and inform recommendations Escalates data/process related problems and communicates to relevant teams in a timely manner and makes recommendations for resolution Provides day-to-day support and delivery of analytics Shareholder Accountabilities: Represents functional area as a business insights & analytics specialized expert Synthesizes complex and vast amount of information and translates into actionable insights and strategy Builds business requirements and facilitates project execution to develop insights Collaborates with partners on business challenges and delivers fact-based analytical advice that aligns to strategy and drives shareholder value Identifies opportunities for business growth within a specific business or function by identifying potential use cases and value drivers Utilizes both quantitative and qualitative methodologies to interpret and present data effectively and clearly Works directly with the business teams to gather the demand for analytics and work with the analytics hub to fulfill the analytics demand Provides business explanation for anomalies/outliers identified during analysis Works with business functions and analytics teams to transition business requirements to analytics requirements Trains business users on how to integrate analytics into decisions Leverages knowledge of data capabilities to build and deliver insights Develops analysis to corroborate initial proof of concept Executes on data requests accurately and within a timely manner Identifies and investigates data/analytics related issues Ensures business operations are in compliance with applicable internal and external requirements (e.g. financial controls, segregation of duties, transaction approvals and physical control of assets) Leads/facilitates and/or implements action/remediation plans to address performance/risk/governance issues Actively manages relationships within and across various business lines, corporate and/or control functions and ensures alignment with enterprise and/or regulatory requirements Keeps abreast of emerging issues, trends, and evolving regulatory requirements and assesses potential impacts Maintains a culture of risk management and control, supported by effective processes in alignment with risk appetite Employee/Team Accountabilities: Participates fully as a member of the team, supports a positive work environment that promotes service to the business, quality, innovation and teamwork and ensures timely communication of issues/points of interest Provides thought leadership and/or industry knowledge for own area of expertise in own area and participates in knowledge transfer within the team and business unit Keeps current on emerging trends/developments and grows knowledge of the business, related tools and techniques Participates in personal performance management and development activities, including cross training within own team Keeps others informed and up to date about the status/progress of projects and/or all relevant or useful information related to day-to-day activities Contributes to team development of skills and capabilities through mentorship of others, by sharing knowledge and experiences and leveraging best practices Leads, motivates and develops relationships with internal and external business partners/stakeholders to develop productive working relationships Contributes to a fair, positive and equitable environment that supports a diverse workforce Acts as a brand ambassador for your business area/function and the bank, both internally and/or externally Physical Requirements: Never: 0%; Occasional: 1-33%; Frequent: 34-66%; Continuous: 67-100% Domestic Travel - Occasional International Travel - Never Performing sedentary work - Continuous Performing multiple tasks - Continuous Operating standard office equipment - Continuous Responding quickly to sounds - Occasional Sitting - Continuous Standing - Occasional Walking - Occasional Moving safely in confined spaces - Occasional Lifting/Carrying (under 25 lbs.) - Occasional Lifting/Carrying (over 25 lbs.) - Never Squatting - Occasional Bending - Occasional Kneeling - Never Crawling - Never Climbing - Never Reaching overhead - Never Reaching forward - Occasional Pushing - Never Pulling - Never Twisting - Never Concentrating for long periods of time - Continuous Applying common sense to deal with problems involving standardized situations - Continuous Reading, writing and comprehending instructions - Continuous Adding, subtracting, multiplying and dividing - Continuous The above statements are intended to describe the general nature and level of work being performed by people assigned to this job. They are not intended to be an exhaustive list of all responsibilities, duties and skills required. The listed or specified responsibilities & duties are considered essential functions for ADA purposes. Who We Are: TD is one of the world's leading global financial institutions and is the fifth largest bank in North America by branches/stores. Every day, we deliver legendary customer experiences to over 27 million households and businesses in Canada, the United States and around the world. More than 95,000 TD colleagues bring their skills, talent, and creativity to the Bank, those we serve, and the economies we support. We are guided by our vision to Be the Better Bank and our purpose to enrich the lives of our customers, communities and colleagues. TD is deeply committed to being a leader in customer experience, that is why we believe that all colleagues, no matter where they work, are customer facing. As we build our business and deliver on our strategy, we are innovating to enhance the customer experience and build capabilities to shape the future of banking. Whether you've got years of banking experience or are just starting your career in financial services, we can help you realize your potential. Through regular leadership and development conversations to mentorship and training programs, we're here to support you towards your goals. As an organization, we keep growing - and so will you. Our Total Rewards Package Our Total Rewards package reflects the investments we make in our colleagues to help them and their families achieve their financial, physical and mental well-being goals. Total Rewards at TD includes base salary and variable compensation/incentive awards (e.g., eligibility for cash and/or equity incentive awards, generally through participation in an incentive plan) and several other key plans such as health and well-being benefits, savings and retirement programs, paid time off (including Vacation PTO, Flex PTO, and Holiday PTO), banking benefits and discounts, career development, and reward and recognition. Learn more Additional Information: We're delighted that you're considering building a career with TD. Through regular development conversations, training programs, and a competitive benefits plan, we're committed to providing the support our colleagues need to thrive both at work and at home. Colleague Development If you're interested in a specific career path or are looking to build certain skills, we want to help you succeed. You'll have regular career, development, and performance conversations with your manager, as well as access to an online learning platform and a variety of mentoring programs to help you unlock future opportunities. Whether you have a passion for helping customers and want to expand your experience, or you want to coach and inspire your colleagues, there are many different career paths within our organization at TD - and we're committed to helping you identify opportunities that support your goals. Training & Onboarding We will provide training and onboarding sessions to ensure that you've got everything you need to succeed in your new role. Interview Process We'll reach out to candidates of interest to schedule an interview. We do our best to communicate outcomes to all applicants by email or phone call. Accommodation TD Bank is an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, age, disability, status as a protected veteran or any other characteristic protected under applicable federal, state, or local law. If you are an applicant with a disability and need accommodations to complete the application process, please email TD Bank US Workplace Accommodations Program at ***************. Include your full name, best way to reach you and the accommodation needed to assist you with the applicant process.
    $95.3k-155.4k yearly Auto-Apply 60d+ ago
  • Managing Consultant, Air Quality

    Ramboll 4.6company rating

    Business advisor job in Princeton Meadows, NJ

    Founded in Denmark, Ramboll is a foundation-owned people company. We have more than 18,000 experts working across our global operations in 35 countries with thousands of experts working across 70 offices in the Americas. Our experts are leaders in their fields, developing and delivering innovative solutions in diverse markets including Buildings, Transport, Planning & Urban Design, Water, Environment & Health, Energy, and Management Consulting. We invite you to contribute to a more sustainable future working in an open, collaborative, and empowering company. Combining local experience with global knowledge, we together shape the societies of tomorrow. Job Description Job location: Albany, NY, Princeton, NJ, or Blue Bell, PA. Are you eager to develop your excellence in an inclusive, collaborative, and empowering community? Are you excited about joining a company that strives to make a difference - for its employees, clients, and society? Are you motivated by creating sustainable change that benefits society and nature? If this sounds interesting to you, or you're curious to learn more, then this role could be the perfect opportunity for you. Join our team and work with us to close the gap to a sustainable future. Your new role As our new Managing Consultant with air quality compliance & permitting consulting experience, you will be part of Ramboll's Environment & Health Division. This group consists of people who are passionate about air quality, and other environmental regulatory compliance, while assisting Ramboll's clients with their most challenging problems. The services and support provided to our clients within various industries range across a variety of topics, including but not limited to air permit applications, emissions estimation, preparation of air compliance related reports, air dispersion modeling, and general regulatory compliance. Your key tasks and responsibilities will be: Critically reviewing and interpreting local, state, and federal environmental regulations, with focus on air compliance Maintaining client relationships and managing the development of deliverables to meet client needs in an efficient manner Serving as the technical lead overseeing Consultant-level staff on complex projects Estimating emissions and conducting engineering evaluations of air pollution sources Supporting air dispersion modeling of air pollution dispersion Preparing all levels of air quality permit applications and environmental reports EPCRA Tier II and TRI Reporting Other environmental regulatory compliance experience consider a plus Your new team As part of the team, you will be part of a creative group, filled with people who are really excited about solving clients' problems and creating sustainable solutions for them. You will work with all levels of technical expertise from entry level team members to members with decades of experience, many of whom are subject matter experts in their own fields. And you will engage in a continual learning environment through coaching, mentoring, and on the job tasks. About you From the moment you join Ramboll, we will support your personal and professional development so that you grow with the company. For this role, we believe your starting point is: B.S. or M.S. in Chemical, Mechanical, Civil, or Environmental Engineering or science discipline (air quality course work is a plus) 9+ years of air quality related experience Strong computing skills including high level use of spreadsheets and word processing Strong written/verbal communication, problem-solving and organization skills Demonstrated capabilities in understanding, interpreting, and applying environmental regulations to real-world situations Programming, database and GIS skills are preferred but not required What we can offer you Interesting and diverse projects The opportunity to work with some of the best and brightest professionals in your field Flexible work arrangements Generous Paid Time Off Excellent health and retirement benefits Investment in your development Leaders you can count on, guided by our Leadership Principles Appreciation for the unique person you are The long-term thinking of a foundation-owned company Inspiration from colleagues, clients, and projects Salary Transparency Statement At Ramboll, your base pay is only part of your overall total compensation package. At the time of this posting, this role is likely to be compensated at an annual base salary in the New York area between $114,000 and $143,000. Actual pay may be more or less than the posted range, depending on numerous factors, including experience, geographical location, internal equity, market conditions, education/training and skill level, and does not include bonuses, overtime, or other forms of compensation or benefits. Work at the heart of sustainable change Ramboll is a global architecture, engineering, and consultancy company. We believe that the purpose of sustainable change is to create a thriving world for both nature and people. So, that's where we start - and how we work. At Ramboll, our core strength is our people, and our history is rooted in a clear vision of how a responsible company should act. Being open and curious is a cornerstone of our culture. We embrace an inclusive mindset that looks for fresh, diverse, and innovative perspectives. We respect, embrace, and invite diversity in all forms to actively cultivate an environment where everyone can flourish and realize their full potential. Ready to join us? Please submit your application. Be sure to include all relevant documents including your CV and a cover letter connecting your background to the responsibilities of the position. Please note, applicants must be currently authorized to work in the United States on a full-time basis. No sponsorship is available for this position. We recognize that some candidates only apply when they tick every box. However, passion and potential often outweigh a perfect resume and Ramboll's supportive learning culture can help you grow. So, if this role resonates with you but you don't meet all the requirements, we encourage you to apply. You might be the perfect fit for this opportunity or another within our team. Thank you for taking the time to apply, we look forward to receiving your application! An equal opportunity employer Equality, diversity, and inclusion is at the heart of what we do. At Ramboll, we believe that diversity is a strength, and that different experiences and perspectives are essential to creating truly sustainable societies. We invite applications from candidates of all backgrounds, regardless of age, disability or medical condition, gender identity, marriage and domestic partnership, pregnancy and maternity, race, ancestry, or national origin, religion or belief, sex and sexual orientation, military service and veteran status, or any other protected characteristic Additional Information All your information will be kept confidential according to EEO guidelines.
    $114k-143k yearly 20d ago
  • Business Development Associate

    Apollo Executives 4.3company rating

    Business advisor job in Philadelphia, PA

    We are a business development and sales company that executes promotional campaigns to drive sales on behalf of our brand partners. Our partners rely on us to increase revenue, generate positive experiences, and raise customer satisfaction ratings. The primary responsibility of the Business Development Associate is to create business and sales opportunities through direct-to-consumer campaigns. They will actively engage and deliver compelling product presentations in an effort to increase revenue and generate sales. Additionally, as the Business Development Associate, you will have the opportunity to take on leadership and managerial responsibilities upon successfully achieving KPIs set by senior management. If you're a passionate self-starter with an interest in business development, growth, and client relations, we look forward to hearing from you! What You'll Do as a Business Development Associate: Prospect potential customers/business opportunities by vetting warm leads Build and maintain relationships with customers, stakeholders, clients, and fellow staff Work closely with the sales and customer service teams to maintain KPIs at high levels Identify areas of improvement and communicate feedback professionally and effectively Monitor sales and customer service pipelines, track progress, and hold regular meetings with appropriate staff Examine profit and loss statements to ensure company funds are utilized appropriately Convert sales leads into valuable long-term customers by utilizing stellar customer service What We're Looking For in a Business Development Associate: A bachelor's degree or equivalent, preferred 1+ years of experience in business development and/or management, preferred Ambitious self-starters with a passion for client relations and business development Critical thinking skills, the ability to come up with creative solutions on your feet A team player who's able to communicate effectively with fellow staff and customers Familiarity with sales, lead generation, customer service, or business development practices is a plus Growth-oriented individuals looking to grow with a company long-term Why Join Us? Travel opportunities- all transportation & accommodation expenses covered! Internal growth opportunities- we only promote from within our company! Comprehensive business development guidance & mentorship Commission bonuses are available with uncapped earning potential Competitive weekly pay
    $45k-64k yearly est. Auto-Apply 21d ago
  • Business Development

    Coretitle

    Business advisor job in Mount Laurel, NJ

    CORE is currently seeking a hardworking and experienced Title Insurance Sales Representative. Join one of South Jersey's fastest growing title companies and most successful title team! Whether you have a well-established client base or need help taking your business to the next level, we want to meet. Increase overall resale and refinance market share in the New Jersey and Pennsylvania market by building strong relationships with REALTORS, mortgage brokers and loan originators, banks, credit unions. Team player who acts as the liaison between the inside office staff and clients in the field. Must be confident in making cold calls, prospecting for leads, as well as maintaining current customer's needs. Strong social media presence is a plus. Develop and initiate new sales and marketing ideas. Actively pursue office presentations with office brokers and staff Knowledge of real estate business is extremely helpful. Consistently increase business and revenues Candidate must possess the following: Strong work ethic. Must provide own reliable transportation. Superior time management skills OTHER REQUIREMENTS: Attending outside functions both during the day and some evenings Excellent interpersonal communication skills (both written and verbal) Ability to effectively present information one-on-one and in group settings Maintain a professional appearance and providing a positive company image EDUCATION: Minimum High School or equivalent (required) Degree in Sales and Marketing (preferred) EXPERIENCE: 2-5 years of successful sales experience in the Real Estate industry Salary is commensurate with experience Job Type: Full-time
    $76k-120k yearly est. 60d+ ago
  • ORM Lead Business Insights Specialist, Stress Testing & Scenario Analysis

    TDI 4.1company rating

    Business advisor job in Mount Laurel, NJ

    Hours: 40 Pay Details: $122,304 - $199,680 USD TD is committed to providing fair and equitable compensation opportunities to all colleagues. Growth opportunities and skill development are defining features of the colleague experience at TD. Our compensation policies and practices have been designed to allow colleagues to progress through the salary range over time as they progress in their role. The base pay actually offered may vary based upon the candidate's skills and experience, job-related knowledge, geographic location, and other specific business and organizational needs. As a candidate, you are encouraged to ask compensation related questions and have an open dialogue with your recruiter who can provide you more specific details for this role. Line of Business: Analytics, Insights, & Artificial Intelligence Job Description: Department Overview:ORM Lead Business Insights Specialist, Stress Testing & Scenario Analysis will serve as a key resource leading ORM's stress testing and scenario analysis program. This role requires ability to execute advanced quantitative modeling along with managing high-stakes regulatory governance.The Lead Business Insights Specialist acts as an advisor to business leaders and stakeholders. This role provides comprehensive analytical support, interpretation of complex data, BI or analytics outcomes to generate multidimensional insights that drive business growth and value. This role works in partnership with business leaders to present or generate appropriate insights including the delivery of supporting collateral and/or presentations.Depth & Scope: Generally accountable for a significant business or area that has cross business or enterprise-wide impact or accountability Enterprise domain/functional and deep specialized knowledge at the enterprise, business, regulatory and industry levels Undertakes and completes a variety of complex initiatives requiring seasoned specialist knowledge and/or the integration of cross functional processes Typically deals with senior/executive management Focuses on longer-range planning for functional area (e.g. 12 months or greater) May manage and prioritize multiple projects at a given time May interact with any hierarchy level up to executive leaders and external vendors Primary Accountabilities: Regulatory Execution: Lead the end-to-end delivery of the ORM Stress Testing Program, ensuring all regulatory requirements for operational risk losses and capital are met within required timelines. Scope: Manage the execution of: US Regulatory: Dodd-Frank Act Stress Testing (DFAST) and Comprehensive Capital Analysis and Review (CCAR). Canadian Regulatory: OSFI Macro Stress Test (MST). Internal: Annual Enterprise-wide Stress Test (EWST) and ad-hoc requests. Scenario Analysis: Lead the development and implementation of the Scenario Analysis program, ensuring alignment with enterprise standards and regulatory requirements. Methodology & Documentation: Aid in the development and execution of the methodology, procedures, and documentation for operational risk stress testing programs. Collaboration: Partner extensively with key stakeholders to ensure program success, including Model Development and Model Validation, ORM Internal Loss Event Data team, Enterprise Capital Stress Testing, US CCAR Governance team, Finance, Regulators, and External Consultants Advanced Analytics: Utilize Python to handle large datasets and apply modeling techniques such as Loss Distribution Approach (LDA), Regression Modeling, and Scenario Analysis to forecast losses. Process Automation: Design and deploy Power Automate flows to streamline data collection from stakeholders (e.g., Scenario Analysis workshops) and automate approval workflows. Reporting & Visualization: Build and maintain Power BI dashboards to visualize stress test results and scenario impacts for senior management and the US CCAR Governance team. Preferred Qualifications: 5+ years of experience in stress testing (CCAR/DFAST), operational risk modeling, or capital planning. Experience with OSFI (Canada) regulatory requirements is a strong asset, in addition to US Fed requirements. Master's degree in a quantitative discipline (Finance, Statistics, Economics, Data Science). Proficient in data manipulation (Pandas) and statistical modeling. Advanced skills in Power BI (reporting) and Power Automate (workflow optimization). Deep understanding of operational risk capital methodologies (LDA, Monte Carlo, Frequency/Severity modeling). Proven ability to manage regulatory relationships and defend methodologies to Model Validation and Audit. Strong leadership skills to oversee a focused team of professionals. Education & Experience: Undergraduate degree or advanced technical degree preferred (e.g., math, physics, engineering, finance or computer science) Graduate's degree preferred with either progressive project work experience, or; 7+ year of relevant experience; higher degree education and research tenure can be counted Customer Accountabilities: Leads on the interpretation of complex business issues, generates multifaceted insights and identifies opportunities to help drive business growth or address business/enterprise needs Presents and communicates generated insights and recommended business actions to stakeholders/business leaders in an easily digestible manner, leveraging tools/techniques/methods to produce a variety of visualizations/presentations that fit the audience Acts as the primary interface with business to bridge and translate business requirements to analytics and reporting needs for a given domain/business Applies collaborative and strong stakeholder management approach to constructively influence and persuade stakeholders and partners where appropriate Serves as an authority on a given business domain and provides business expertise to place context around analytics discovery and inform recommendations Escalates data/process related problems and communicates to relevant teams in a timely manner and makes recommendations for resolution Provides day-to-day support and delivery of analytics Shareholder Accountabilities: Represents functional area as a business insights & analytics specialized expert Synthesizes complex and vast amount of information and translates into actionable insights and strategy Builds business requirements and facilitates project execution to develop insights Collaborates with partners on business challenges and delivers fact-based analytical advice that aligns to strategy and drives shareholder value Identifies opportunities for business growth within a specific business or function by identifying potential use cases and value drivers Utilizes both quantitative and qualitative methodologies to interpret and present data effectively and clearly Works directly with the business teams to gather the demand for analytics and work with the analytics hub to fulfill the analytics demand Provides business explanation for anomalies/outliers identified during analysis Works with business functions and analytics teams to transition business requirements to analytics requirements Trains business users on how to integrate analytics into decisions Leverages knowledge of data capabilities to build and deliver insights Develops analysis to corroborate initial proof of concept Executes on data requests accurately and within a timely manner Identifies and investigates data/analytics related issues Ensures business operations are in compliance with applicable internal and external requirements (e.g. financial controls, segregation of duties, transaction approvals and physical control of assets) Leads/facilitates and/or implements actions/remediation plans to address performance/risk/governance issues Actively manages relationships within and across various business lines, corporate and/or control functions and ensures alignment with enterprise and/or regulatory requirements Keeps abreast of emerging issues, trends, and evolving regulatory requirements and assesses potential impacts Maintains a culture of risk management and control, supported by effective processes in alignment with risk appetite Employee/Team Accountabilities: Participates fully as a member of the team, supports a positive work environment that promotes service to the business, quality, innovation and teamwork and ensures timely communication of issues/points of interest Provides thought leadership and/or industry knowledge for own area of expertise in own area and participates in knowledge transfer within the team and business unit Keeps current on emerging trends/developments and grows knowledge of the business, related tools and techniques Participates in personal performance management and development activities, including cross training within own team Keeps others informed and up to date about the status/progress of projects and/or all relevant or useful information related to day-to-day activities Contributes to team development of skills and capabilities through mentorship of others, by sharing knowledge and experiences and leveraging best practices Leads, motivates and develops relationships with internal and external business partners/stakeholders to develop productive working relationships Contributes to a fair, positive and equitable environment that supports a diverse workforce Acts as a brand ambassador for your business area/function and the bank, both internally and/or externally Physical Requirements:Never: 0%; Occasional: 1-33%; Frequent: 34-66%; Continuous: 67-100% Domestic Travel - Occasional International Travel - Never Performing sedentary work - Continuous Performing multiple tasks - Continuous Operating standard office equipment - Continuous Responding quickly to sounds - Occasional Sitting - Continuous Standing - Occasional Walking - Occasional Moving safely in confined spaces - Occasional Lifting/Carrying (under 25 lbs.) - Occasional Lifting/Carrying (over 25 lbs.) - Never Squatting - Occasional Bending - Occasional Kneeling - Never Crawling - Never Climbing - Never Reaching overhead - Never Reaching forward - Occasional Pushing - Never Pulling - Never Twisting - Never Concentrating for long periods of time - Continuous Applying common sense to deal with problems involving standardized situations - Continuous Reading, writing and comprehending instructions - Continuous Adding, subtracting, multiplying and dividing - Continuous The above statements are intended to describe the general nature and level of work being performed by people assigned to this job. They are not intended to be an exhaustive list of all responsibilities, duties and skills required. The listed or specified responsibilities & duties are considered essential functions for ADA purposes.#LI-AMCBCorporate Who We Are: TD is one of the world's leading global financial institutions and is the fifth largest bank in North America by branches/stores. Every day, we deliver legendary customer experiences to over 27 million households and businesses in Canada, the United States and around the world. More than 95,000 TD colleagues bring their skills, talent, and creativity to the Bank, those we serve, and the economies we support. We are guided by our vision to Be the Better Bank and our purpose to enrich the lives of our customers, communities and colleagues. TD is deeply committed to being a leader in customer experience, that is why we believe that all colleagues, no matter where they work, are customer facing. As we build our business and deliver on our strategy, we are innovating to enhance the customer experience and build capabilities to shape the future of banking. Whether you've got years of banking experience or are just starting your career in financial services, we can help you realize your potential. Through regular leadership and development conversations to mentorship and training programs, we're here to support you towards your goals. As an organization, we keep growing - and so will you. Our Total Rewards Package Our Total Rewards package reflects the investments we make in our colleagues to help them and their families achieve their financial, physical and mental well-being goals. Total Rewards at TD includes base salary and variable compensation/incentive awards (e.g., eligibility for cash and/or equity incentive awards, generally through participation in an incentive plan) and several other key plans such as health and well-being benefits, savings and retirement programs, paid time off (including Vacation PTO, Flex PTO, and Holiday PTO), banking benefits and discounts, career development, and reward and recognition. Learn more Additional Information: We're delighted that you're considering building a career with TD. Through regular development conversations, training programs, and a competitive benefits plan, we're committed to providing the support our colleagues need to thrive both at work and at home. Colleague Development If you're interested in a specific career path or are looking to build certain skills, we want to help you succeed. You'll have regular career, development, and performance conversations with your manager, as well as access to an online learning platform and a variety of mentoring programs to help you unlock future opportunities. Whether you have a passion for helping customers and want to expand your experience, or you want to coach and inspire your colleagues, there are many different career paths within our organization at TD - and we're committed to helping you identify opportunities that support your goals. Training & Onboarding We will provide training and onboarding sessions to ensure that you've got everything you need to succeed in your new role. Interview Process We'll reach out to candidates of interest to schedule an interview. We do our best to communicate outcomes to all applicants by email or phone call. Accommodation TD Bank is an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, age, disability, status as a protected veteran or any other characteristic protected under applicable federal, state, or local law. If you are an applicant with a disability and need accommodations to complete the application process, please email TD Bank US Workplace Accommodations Program at ***************. Include your full name, best way to reach you and the accommodation needed to assist you with the applicant process.
    $54k-83k yearly est. Auto-Apply 8d ago
  • Business Insights Specialist (US)

    TD Bank 4.5company rating

    Business advisor job in Mount Laurel, NJ

    Mount Laurel, New Jersey, United States of America **Hours:** 40 **Pay Details:** $92,220 - $149,310 USD TD is committed to providing fair and equitable compensation opportunities to all colleagues. Growth opportunities and skill development are defining features of the colleague experience at TD. Our compensation policies and practices have been designed to allow colleagues to progress through the salary range over time as they progress in their role. The base pay actually offered may vary based upon the candidate's skills and experience, job-related knowledge, geographic location, and other specific business and organizational needs. As a candidate, you are encouraged to ask compensation related questions and have an open dialogue with your recruiter who can provide you more specific details for this role. **Line of Business:** Analytics, Insights, & Artificial Intelligence **:** The Business Insights Specialist is responsible for conducting analyses on curated and/or aggregated DataMart's in conjunction with deep business subject matter expertise, to generate relevant analytical insights for business issues and identify opportunities to drive business growth and value. This role works in partnership with business leaders to present or generate appropriate insights including the delivery of supporting collateral and/or presentations. Job Description **Depth & Scope:** + Works autonomously and accountable for acting as a lead within a specialized business management function and may provide work direction to others + Provides seasoned specialized knowledge, advice and/or guidance to various stakeholders and team members + Scope of role may have enterprise impact + Focuses on short to medium - term issues (e.g. 6-12 months) + Undertakes and completes a variety of complex projects and initiatives requiring specialist knowledge and/or the integration of cross functional processes within own area of expertise + Oversees and/or independently performs tasks from end-to-end + May interact with any hierarchy level up to executive leaders and external vendors **Education & Experience:** + Undergraduate degree or advanced technical degree preferred (e.g., math, physics, engineering, finance or computer science) Graduate's degree preferred with either progressive project work experience, or; + 5+ year of relevant experience; higher degree education and research tenure can be counted **Preferred Skills:** + Experience with PowerBI or Tableau + Data Analytics & Technology Skills + Ability to prioritize and work in a fast-paced environment + Relevant Audit experience is a plus, but not required **Customer Accountabilities:** + Leads on the interpretation of complex business issues, generates multifaceted insights and identifies opportunities to help drive business growth or address business/enterprise needs + Presents and communicates generated insights and recommended business actions to stakeholders/business leaders in an easily digestible manner, leveraging tools/techniques/methods to produce a variety of visualizations/presentations that fit the audience + Acts as the primary interface with business to bridge and translate business requirements to analytics and reporting needs for a given domain/business + Applies collaborative and strong stakeholder management approach to constructively influence and persuade stakeholders and partners where appropriate + Serves as an authority on a given business domain and provides business expertise to place context around analytics discovery and inform recommendations + Escalates data/process related problems and communicates to relevant teams in a timely manner and makes recommendations for resolution + Provides day-to-day support and delivery of analytics **Shareholder Accountabilities:** + Represents functional area as a business insights & analytics specialized expert + Synthesizes complex and vast amount of information and translates into actionable insights and strategy + Builds business requirements and facilitates project execution to develop insights + Collaborates with partners on business challenges and delivers fact-based analytical advice that aligns to strategy and drives shareholder value + Identifies opportunities for business growth within a specific business or function by identifying potential use cases and value drivers + Utilizes both quantitative and qualitative methodologies to interpret and present data effectively and clearly + Works directly with the business teams to gather the demand for analytics and work with the analytics hub to fulfill the analytics demand + Provides business explanation for anomalies/outliers identified during analysis + Works with business functions and analytics teams to transition business requirements to analytics requirements + Trains business users on how to integrate analytics into decisions + Leverages knowledge of data capabilities to build and deliver insights + Develops analysis to corroborate initial proof of concept + Executes on data requests accurately and within a timely manner + Identifies and investigates data/analytics related issues + Ensures business operations are in compliance with applicable internal and external requirements (e.g. financial controls, segregation of duties, transaction approvals and physical control of assets) + Leads/facilitates and/or implements action/remediation plans to address performance/risk/governance issues + Actively manages relationships within and across various business lines, corporate and/or control functions and ensures alignment with enterprise and/or regulatory requirements + Keeps abreast of emerging issues, trends, and evolving regulatory requirements and assesses potential impacts + Maintains a culture of risk management and control, supported by effective processes in alignment with risk appetite **Employee/Team Accountabilities:** + Participates fully as a member of the team, supports a positive work environment that promotes service to the business, quality, innovation and teamwork and ensures timely communication of issues/points of interest + Provides thought leadership and/or industry knowledge for own area of expertise in own area and participates in knowledge transfer within the team and business unit + Keeps current on emerging trends/developments and grows knowledge of the business, related tools and techniques + Participates in personal performance management and development activities, including cross training within own team + Keeps others informed and up to date about the status/progress of projects and/or all relevant or useful information related to day-to-day activities + Contributes to team development of skills and capabilities through mentorship of others, by sharing knowledge and experiences and leveraging best practices + Leads, motivates and develops relationships with internal and external business partners/stakeholders to develop productive working relationships + Contributes to a fair, positive and equitable environment that supports a diverse workforce + Acts as a brand ambassador for your business area/function and the bank, both internally and/or externally + Contribute to data deliverables including Internal, Senior Management, and Audit Committee Reporting + Apply automation and innovation on data platforms to support business function + Design and implement complex business data information management frameworks to provide a solution that meets business requirements + Understand business data and provide analysis and requirements to ensure the data design / development initiatives are in line with the planned design and standards + Conduct meaningful analysis at the functional or enterprise level using results to draw conclusions, make recommendations, assess the effectiveness of programs/ policies/ practices. + Implement continuous process / performance improvements where opportunities exist. \#LI-AMCBCorporate \#IN-AMCBCorporate **Who We Are:** TD is one of the world's leading global financial institutions and is the fifth largest bank in North America by branches/stores. Every day, we deliver legendary customer experiences to over 27 million households and businesses in Canada, the United States and around the world. More than 95,000 TD colleagues bring their skills, talent, and creativity to the Bank, those we serve, and the economies we support. We are guided by our vision to Be the Better Bank and our purpose to enrich the lives of our customers, communities and colleagues. TD is deeply committed to being a leader in customer experience, that is why we believe that all colleagues, no matter where they work, are customer facing. As we build our business and deliver on our strategy, we are innovating to enhance the customer experience and build capabilities to shape the future of banking. Whether you've got years of banking experience or are just starting your career in financial services, we can help you realize your potential. Through regular leadership and development conversations to mentorship and training programs, we're here to support you towards your goals. As an organization, we keep growing - and so will you. **Our Total Rewards Package** Our Total Rewards package reflects the investments we make in our colleagues to help them and their families achieve their financial, physical and mental well-being goals. Total Rewards at TD includes base salary and variable compensation/incentive awards (e.g., eligibility for cash and/or equity incentive awards, generally through participation in an incentive plan) and several other key plans such as health and well-being benefits, savings and retirement programs, paid time off (including Vacation PTO, Flex PTO, and Holiday PTO), banking benefits and discounts, career development, and reward and recognition. Learn more (*************************************** **Additional Information:** We're delighted that you're considering building a career with TD. Through regular development conversations, training programs, and a competitive benefits plan, we're committed to providing the support our colleagues need to thrive both at work and at home. **Colleague Development** If you're interested in a specific career path or are looking to build certain skills, we want to help you succeed. You'll have regular career, development, and performance conversations with your manager, as well as access to an online learning platform and a variety of mentoring programs to help you unlock future opportunities. Whether you have a passion for helping customers and want to expand your experience, or you want to coach and inspire your colleagues, there are many different career paths within our organization at TD - and we're committed to helping you identify opportunities that support your goals. **Training & Onboarding** We will provide training and onboarding sessions to ensure that you've got everything you need to succeed in your new role. **Interview Process** We'll reach out to candidates of interest to schedule an interview. We do our best to communicate outcomes to all applicants by email or phone call. **Accommodation** TD Bank is an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, age, disability, status as a protected veteran or any other characteristic protected under applicable federal, state, or local law. If you are an applicant with a disability and need accommodations to complete the application process, please email TD Bank US Workplace Accommodations Program at *************** . Include your full name, best way to reach you and the accommodation needed to assist you with the applicant process. Federal law prohibits job discrimination based on race, color, sex, sexual orientation, gender identity, national origin, religion, age, equal pay, disability and genetic information.
    $92.2k-149.3k yearly 60d+ ago

Learn more about business advisor jobs

How much does a business advisor earn in Bensalem, PA?

The average business advisor in Bensalem, PA earns between $67,000 and $149,000 annually. This compares to the national average business advisor range of $67,000 to $138,000.

Average business advisor salary in Bensalem, PA

$100,000

What are the biggest employers of Business Advisors in Bensalem, PA?

The biggest employers of Business Advisors in Bensalem, PA are:
  1. SAP
Job type you want
Full Time
Part Time
Internship
Temporary