Post job

Business advisor jobs in Hamilton, NJ

- 1,201 jobs
All
Business Advisor
Business Specialist
Business Developer
Business Consultant
Business Internship
Management Consultant
Vice President, Business Development
Business Process Consultant
Senior Management Consultant
Senior Business Consultant
Business Development Internship
Specialist-Small Business
Business To Business Sales Consultant
  • Sap Business Warehouse Developer

    Insight Global

    Business advisor job in Philadelphia, PA

    Required Skills & Experience - Bachelor's degree in Computer Science, Engineering, Mathematics, or equivalent experience. - 3-5 years of hands-on experience in SAP BW development. - Strong proficiency in S/4HANA modeling and performance tuning. - Experience with SAP Data Sphere for integration and analytics. - Solid understanding of BDC programming for data migration. - Excellent problem-solving and communication skills. Nice to Have Skills & Experience - Familiarity with cloud-based data solutions and security best practices. - Experience working in Agile or hybrid project environments. Job Description One of Insight Global's clients is seeking a skilled SAP BW Developer to design, develop, and maintain data solutions that support business intelligence and analytics. The ideal candidate will have hands-on expertise in SAP BW, Data Sphere, BDC, and HANA modeling, ensuring robust and efficient data integration and reporting. The role is onsite 3 days a week in Philadelphia, PA. Responsibilities: - Develop and maintain SAP BW data models and queries to support business reporting. - Design and implement HANA modeling solutions for optimized performance. - Utilize SAP Data Sphere for data integration and advanced analytics. - Perform BDC programming for data migration and automation tasks. - Collaborate with stakeholders to gather requirements and deliver technical solutions. Pay: Starting at 65/hr.+
    $84k-133k yearly est. 6d ago
  • Senior Management Consultant-Retail

    Fractal 4.2company rating

    Business advisor job in Burlington, NJ

    Senior Management Consultant- Retail ****Philadelphia, New Jersey or New York area and can commute to the client office Fractal is a strategic AI partner to Fortune 500 companies with a vision to power every human decision in the enterprise. Fractal is building a world where individual choices, freedom, and diversity are the greatest assets. An ecosystem where human imagination is at the heart of every decision. Where no possibility is written off, only challenged to get better. We believe that a true Fractalite is the one who empowers imagination with intelligence. Fractal has been featured as a Great Place to Work by The Economic Times in partnership with the Great Place to Work Institute and recognized as a ‘Cool Vendor' and a ‘Vendor to Watch' by Gartner. Please visit Fractal | Intelligence for Imagination for more information about Fractal. Job Description We are looking for a Senior Decision Scientist in Retail, who is proficient with analytics consulting and solving complex business problems in the world of retail, particularly store operations, asset protection, merchandising and strategy. Solve business problems using data-driven models (75%) Take business problem and build structured analytical approaches to solving, inclusive of identifying needed data, analysis required, and strategy for synthesizing and presenting the analysis results Design and build analytical solutions to enable recurring analysis of business performance Effectively scope, size, and plan the development of analytical solutions and set expectations accordingly Translate high level business problems into discrete questions that can be answered by using data-driven models Identify opportunities to improve business performance through use of analytical approaches Translate output of models into recommendations for how the business can operate differently Collaborative Relationships (25%) • Develop and maintain effective working relationships with members of cross-functional teams. • Create a strong partnership with all areas of the organization that require interaction. • Partner with stakeholders to drive implementation of recommendations from analysis • Keep individual, division, and total company goals in mind when making decisions. • Demonstrate and utilize strong communication skills in all interactions. Education: Bachelor's Degree with quantitative coursework (degree in math, science or relevant field); having an MBA is preferred but not required Experience: 3-5 years of experience in analytics, management consulting, or merchandise planning is preferred Experience with Statistical Analysis is preferred Skills and Abilities: Excellent interpersonal, communication and organization skills. Self-motivated, collaborative, with the desire to learn Excellent communication skills and ability to interact with all levels Highly strategic with an ability to take initiative, multi-task, and prioritize projects successfully to meet deadlines Strong project management skills and ability to collaborate productively with many departments Microsoft Office (Excel, Word, PowerPoint) proficiency with clear storyboarding and data handling skills Strong sense of business/retail math with working knowledge of statistical models like Regression/Clustering and Hypothesis Testing Strong analytical skills with the ability to collect, organize, analyze, and disseminate significant amounts of information with attention to detail and accuracy Working knowledge of R/Python for statistical modelling Pay: The wage range for this role takes into account the wide range of factors that are considered in making compensation decisions, including but not limited to skill sets; experience and training; licensure and certifications; and other business and organizational needs. The disclosed range estimate has not been adjusted for the applicable geographic differential associated with the location at which the position may be filled.At Fractal, it is not typical for an individual to be hired at or near the top of the range for their role and compensation decisions are dependent on the facts and circumstances of each case.A reasonable estimate of the current range is: $120,000 - $159,000. In addition, you may be eligible for a discretionary bonus for the current performance period. Benefits: As a full-time employee of the company or as an hourly employee working more than 30 hours per week, you will be eligible to participate in the health, dental, vision, life insurance, and disability plans in accordance with the plan documents, which may be amended from time to time. You will be eligible for benefits on the first day of employment with the Company. In addition, you are eligible to participate in the Company 401(k) Plan after 30 days of employment, in accordance with the applicable plan terms. The Company provides for 11 paid holidays and 12 weeks of Parental Leave. We also follow a “free time” PTO policy, allowing you the flexibility to take the time needed for either sick time or vacation. Fractal provides equal employment opportunities to all employees and applicants for employment and prohibits discrimination and harassment of any type without regard to race, color, religion, age, sex, national origin, disability status, genetics, protected veteran status, sexual orientation, gender identity or expression, or any other characteristic protected by federal, state or local laws
    $120k-159k yearly 3d ago
  • Treasury Management Consultant III & Relationship Manager - Government Banking Northeast

    Capital One 4.7company rating

    Business advisor job in Philadelphia, PA

    Treasury Management Consultant III & Relationship Manager - Government Banking Northeast The Government Banking Treasury Management Consultant (TMC) & Relationship Manager partners with internal stakeholders to be the single point of accountability and advise on prospects' and clients' deposit, treasury management, risk and other liquidity needs. The TMC builds a book of business through deposit growth, maintaining and cross-selling existing clients, and prospecting new-to-bank relationships. The TMC on the Government Banking Treasury Management Sales team will work to identify ways to improve the client experience and enhance Capital One's brand in the marketplace. Seen as a trusted advisor, the TMC works closely with government clients to understand their business, optimize Treasury work flows, and minimize financial and reputational risk. They focus on creating and delivering customized client centric solutions through a consultative approach. This TMC will focus exclusively on Government Banking clients that includes State and Local Municipalities, Public School Districts and Public Universities. Familiarity with the public sector vertical and Government clients' specific banking and financial operations is desirable. This role functions as both the Treasury Management Consultant and Relationship Manager for client relationships and works to generate new-to-bank relationships, while developing existing clients by delivering value-added solutions and working across the product and technology organization to optimize products for evolving client needs. Leveraging their network and collaborating across business lines, the TMC influences strategy to meet the needs of clients while using sound judgement in assessing risk. The TMC is also responsible for developing marketing and portfolio relationship plans specific to their market to drive profitable portfolio growth and net new revenue generation. They will act as the lead for a team of functional partners who will help support Treasury Management, deposit sales processes, and build ongoing relationships. The TMC values and fosters a spirit of teamwork and cooperation across value streams. This position works independently and uses initiative in carrying out client analysis and proposals requiring minimal guidance from the sales leader. Responsibilities: Consistently meet annual financial goals & benchmark competencies by demonstrating the key sales behaviors such as strategy, collaboration & consultation, while building and maintaining a partnership-centric client portfolio Manages portfolio of existing clients with focus on profitable, organic revenue growth and minimizing attrition Manages portfolio of new-to-bank clients with focus on new revenue growth Ability to understand sales and relationship management specific to working with Government Banking clients Independently develops and maintains relationships with clients to maintain and expand existing business Understands treasury management product risk and ensures Capital One credit policies and other risks (e.g., reputational, legal) are adhered to and mitigated Establishes appropriate expectations for onboarding including execution of documentation and ensure ramp of sold services Conducts independent entities to generate new, high-quality and profitable Treasury Management and deposit business to achieve or exceed specific YoY growth goals Takes a role in market by actively engaging in local industry associations, conferences, networking groups and community associations Identifies working capital efficiency opportunities for an entity and deepens relationship accordingly; ensures awareness of market and industry trends; identifies dissatisfiers and escalates appropriately Identifies and refers ancillary business opportunities to appropriate partners Designs customer-centric treasury management solutions, and provides consultative expertise on the liquidity management cycle Identifies both internal and external prospects. Develops and maintains relationships with prospects to profitably expand business Provides thought leadership within and outside the market through, but not limited to, attending and speaking at industry conferences, etc. Engages with internal marketing in the design of sales collateral and company-sponsored marketing Basic Qualifications: High School Diploma, GED, or equivalent certification At least 6 years of financial services experience At least 5 years of sales experience At least 5 years of treasury management experience Preferred Qualifications: Government banking industry experience Bachelor's degree or Military experience At least 7 years of treasury management experience In-depth to advanced treasury management product knowledge Certified Treasury Professional designation or equivalent certification Effective oral and written communication skills Proficiency with Google Workspace or Microsoft Business products At this time, Capital One will not sponsor a new applicant for employment authorization for this position. The minimum and maximum full-time annual salaries for this role are listed below, by location. Please note that this salary information is solely for candidates hired to perform work within one of these locations, and refers to the amount Capital One is willing to pay at the time of this posting. Salaries for part-time roles will be prorated based upon the agreed upon number of hours to be regularly worked. Melville, NY: $168,700 - $192,500 for Treasury Management Consultant III New York, NY: $168,700 - $192,500 for Treasury Management Consultant III Philadelphia, PA: $140,600 - $160,400 for Treasury Management Consultant III Wilmington, DE: $140,600 - $160,400 for Treasury Management Consultant III Candidates hired to work in other locations will be subject to the pay range associated with that location, and the actual annualized salary amount offered to any candidate at the time of hire will be reflected solely in the candidate's offer letter. This role is also eligible to earn performance based incentive compensation, which may include cash bonus(es) and/or long term incentives (LTI). Incentives could be discretionary or non discretionary depending on the plan. Capital One offers a comprehensive, competitive, and inclusive set of health, financial and other benefits that support your total well-being. Learn more at the Capital One Careers website . Eligibility varies based on full or part-time status, exempt or non-exempt status, and management level. This role is expected to accept applications for a minimum of 5 business days.No agencies please. Capital One is an equal opportunity employer (EOE, including disability/vet) committed to non-discrimination in compliance with applicable federal, state, and local laws. Capital One promotes a drug-free workplace. Capital One will consider for employment qualified applicants with a criminal history in a manner consistent with the requirements of applicable laws regarding criminal background inquiries, including, to the extent applicable, Article 23-A of the New York Correction Law; San Francisco, California Police Code Article 49, Sections ; New York City's Fair Chance Act; Philadelphia's Fair Criminal Records Screening Act; and other applicable federal, state, and local laws and regulations regarding criminal background inquiries. If you have visited our website in search of information on employment opportunities or to apply for a position, and you require an accommodation, please contact Capital One Recruiting at 1- or via email at . All information you provide will be kept confidential and will be used only to the extent required to provide needed reasonable accommodations. For technical support or questions about Capital One's recruiting process, please send an email to Capital One does not provide, endorse nor guarantee and is not liable for third-party products, services, educational tools or other information available through this site. Capital One Financial is made up of several different entities. Please note that any position posted in Canada is for Capital One Canada, any position posted in the United Kingdom is for Capital One Europe and any position posted in the Philippines is for Capital One Philippines Service Corp. (COPSSC).
    $168.7k-192.5k yearly 5h ago
  • Advisor, Financial Services & Business Pathway

    Heights Philadelphia

    Business advisor job in Philadelphia, PA

    About this Role: The Advisor, Financial Services & Business (FSB) Pathway will provide critical support to programming that introduces, prepares, and connects students to careers in the financial services and business sector. Reporting to the Associate Director of Career Pathways (FSB), this role focuses on student engagement, program logistics, event coordination, and data tracking to ensure the smooth delivery of pathway programming. This position is ideal for someone who enjoys working directly with students, has strong organizational skills, and is passionate about supporting Philadelphia students, especially Black, Latino, and first-generation-to-college students from low-income communities. You'll be responsible for: Student Engagement & Support Recruiting, onboarding, and maintaining communication with high school and college students participating in FSB Pathway programming. Support in communication for students, providing reminders, light-touch check-ins, and referrals to support sustained participation. Supporting students in navigating their pre- internship journey including: internship applications, reviewing resumes, mock interviews, employer events, and professional development opportunities. Supporting communication and student participation in dual enrollment or other business-related courses. Program Coordination Assisting with logistics for workshops, employer site visits, career panels, and other experiential learning activities. Traveling to assist with implementation of programming at schools and/or partnership sites as needed. Coordinating scheduling, program materials, and communication with students and families. Supporting student-facing research and special projects, such as employer externships or business case competitions, by assisting with logistics and student participation. Data & Administration Tracking attendance, participation, and student progress in Salesforce and related systems. Administering surveys and collecting feedback to evaluate and improve programming. Helping maintain accurate records of internship placements, employer engagement, and student milestones. Team Collaboration Working closely with the Associate Director of Career Pathways (FSB) to implement school-year programming. Collaborating with other coordinators and pathway staff to align programming across schools and career pathways Supporting Heights-wide events, such as career fairs and family engagement nights, as needed. About you: Bachelor's degree (or progress toward degree) preferred. 1-2 years of experience in education, youth development, or workforce development (internships and relevant volunteer experience accepted). Experience working with high school or college-aged students, particularly those from first-generation and underrepresented backgrounds. Strong organizational skills and attention to detail; ability to manage multiple projects. Professional interest or experience in financial services and/or business fields preferred. Ability to travel to partner schools, employer sites, and events across Philadelphia. Availability to work occasional evening or weekend hours as required. Heights employees: Must meet expectations to report in-person on a schedule determined by their direct manager and/or the Vice President of the team. Must meet PA State background check requirements [PA Criminal, PA Child Abuse and FBI Fingerprint Check] at hire and every five years thereafter. Strong orientation to customer service, particularly with regard to students, partners and colleagues Proficiency in Google Suite, Microsoft Office and related applications, as well as use of general office equipment (phones, computers, copiers, etc) Fluency in the use of data and data systems. Maintains appropriate engagement with data entry, reporting and review. Must adhere to COVID safety guidelines as established by Heights and/or its partners. Office-based staff should be mindful of the organization's strong recommendation that staff maintain up to date with COVID vaccination and boosters. Site-based staff must be fully vaccinated against COVID-19 and must submit to any COVID testing or other health screenings as required by the Department of Human Services and/or the School District of Philadelphia. Must be able to work in a busy, often complex work environment that is generally climate controlled. Must be able to lift up to 20 pounds unassisted on an occasional basis. Must be able to sit for long periods of time. Must be able to stand or walk for long periods of time. Access to reliable transportation required
    $81k-124k yearly est. 60d+ ago
  • Business Process Consultant 1

    Collabera 4.5company rating

    Business advisor job in Philadelphia, PA

    Established in 1991, Collabera has been a leader in IT staffing for over 22 years and is one of the largest diversity IT staffing firms in the industry. As a half a billion dollar IT company, with more than 9,000 professionals across 30+ offices, Collabera offers comprehensive, cost-effective IT staffing & IT Services. We provide services to Fortune 500 and mid-size companies to meet their talent needs with high quality IT resources through Staff Augmentation, Global Talent Management, Value Added Services through CLASS (Competency Leveraged Advanced Staffing & Solutions) Permanent Placement Services and Vendor Management Programs. Collabera recognizes true potential of human capital and provides people the right opportunities for growth and professional excellence. Collabera offers a full range of benefits to its employees including paid vacations, holidays, personal days, Medical, Dental and Vision insurance, 401K retirement savings plan, Life Insurance, Disability Insurance. Job Description • Works on enterprise-wide redesign initiatives that will encompass an end to end analysis and future state redesign. • Develops business case for proposed technology, staff and structure changes, including cost estimates. • Develops and leads redesign initiatives, guiding project and cross-functional teams across the business. • May support to M&A integration efforts, possibly taking a lead role. • May coach teams in six sigma process and tools. • Drives business awareness of quality/process methodology. Qualifications • 3-4 years Business Analysis Skills • Great communication both verbal and written (will be working with both on and offshore teams) • Swift (Swift Alliance Access or other • General Banking, International payments skills Additional Information To know more about this position please contact; Angela Galang ************
    $98k-135k yearly est. 60d+ ago
  • SAP FI Treasury Business Process Consultant

    360 It Professionals 3.6company rating

    Business advisor job in Middletown, PA

    360 IT Professionals is a Software Development Company based in Fremont, California that offers complete technology services in Mobile development, Web development, Cloud computing and IT staffing. Merging Information Technology skills in all its services and operations, the company caters to its globally positioned clients by providing dynamic feasible IT solutions. 360 IT Professionals work along with its clients to deliver high-performance results, based exclusively on the one of a kind requirement. Our services are vast and we produce software and web products. We specialize in Mobile development, i.e. iPhone and Android apps. We use Objective C and Swift programming languages to create native applications for iPhone, whereas we use Android Code to develop native applications for Android devices. To create applications that work on cross-platforms, we use a number of frameworks such as Titanium, PhoneGap and JQuery mobile. Furthermore, we build web products and offer services such as web designing, layouts, responsive designing, graphic designing, web application development using frameworks based on model view controller architecture and content management system. Our services also extend to the domain of Cloud Computing, where we provide Salesforce CRM to effectively manage one's business and ease out all the operations by giving an easy platform. Apart from this, we also provide IT Staffing services that can help your organization to a great extent as you can hire highly skilled personnel's through us. We make sure that we deliver performance driven products that are optimally developed as per your organization's needs. Take a shot at us for your IT requirements and experience a radical change. Job Description MUST HAVE: • 5+ years of expertise in the following SAP Modules: o Finance (FI) o Treasury (Investment Management, Cash Management, Debt Management) o Controlling (CO) • At least 1 recent project working in the public sector • Expertise in as many of the following SAP modules as possible: o Funds Management (FM) o Financial Accounting (FA) o General Ledger (GL) o Accounts Payable (AP) o Accounts Receivable (AR) o Fixed Assets (FA) o Budgeting & Forecasting o Banking o Projects Systems (PS) o Plant Maintenance (PM) o Materials Management (MM) o Supplier Relationship Management (SRM) o Human Capital Management including Payroll (HCM) • Experience performing the following functions/tasks with SAP Treasury modules: o Configuration & maintenance o Identifying and correcting configuration issues o Providing support & training to end users o Supporting integration of Treasury & FICO modules with other SAP modules o Creating & maintaining documentation o Additional Information Thanks and Regards, Harry Singh 510 254 3300 EXT:-190 harry.singh(@360itpro.com
    $103k-132k yearly est. 19h ago
  • Vice President, Business Development - Navista

    Cardinal Health 4.4company rating

    Business advisor job in Trenton, NJ

    At Navista, our mission is to empower community oncology practices to deliver patient-centered cancer care. Navista, a Cardinal Health company, is an oncology practice alliance co-created with oncologists and practice leaders that offers advanced support services and technology to help practices remain independent and thrive. True to our name, our experienced team is passionate about helping oncology practices navigate the future. This is an executive leader responsible for leading the strategic growth and development initiatives for Navista. Key responsibilities include expanding the network's reach, fostering partnerships, expanding service line offerings, and driving overall strategy to support the organization's ability to deliver exceptional patient care. The VP of Business Development will be a seasoned leader and advisor, with proven experience partnering with clinicians in oncology and across multiple therapeutic areas. They will be responsible for setting sales targets and marketing goals. Their job duties include developing production and sales goals, driving the overall monetary health of the organization, obtaining new contracts, and overseeing a sales executive. This role reports to the SVP/GM of Navista. **Responsibilities** + Oversee the commercial operations & strategy division, to develop and execute comprehensive strategic development plans aligned with the networks mission and growth objectives + Identify opportunities for expansion, partnerships and programmatic enhancements to advance the networks presence and impact + Identify and foster relationships with healthcare providers, research institutions and other key stakeholders + Define strategic pipeline including opportunities for growth and new revenue streams, such as service line expansion, entering new markets or developing innovative programs + Collaborates with marketing and communications on the development and implementation of branding and marketing strategies to enhance the networks visibility & reputation through development of compelling messaging, promotional materials, and public relations initiatives. + Partners with Corporate Development on identifying and evaluating potential new practices and partnership + Develops and maintains strong relationships with key stakeholders, including internal sales team to drive the overall oncology strategy + Responsible for sales operations and leading and developing a team + Negotiates contracts and agreements + Proven track record of leading Teams responsible for growth through acquisitions, partnerships, and service line expansion. + Strong understanding of practice management, operations, and healthcare regulations **Qualifications** + Bachelor's degree in business administration, healthcare administration, life sciences, or a related field preferred; advanced degree (MBA, Master's in healthcare administration) preferred + 15+ in an executive strategy & development position, or similar title preferred + Demonstrated abilities for success in strategic development, business development, preferably in the healthcare industry, including identifying and evaluating market opportunities, and developing business plans for expansion & growth + Experience in a Business Development or Growth role with a Managed Services Organization (MSO) or in the specialty community practice space preferred + Excellent communication and presentation skills, with the ability to effectively convey the network's mission and impact with physicians, staff and internal stakeholders + Familiarity with Oncology, Urology, or other specialties, including trends, healthcare regulations, treatment modalities, and research advancements + Strong business acumen and financial background, to ensure efficient allocation of resources and maximize returns on investments + Experience with leading and managing diverse teams, including hiring, training and evaluating performance + Strong analytical and problem-solving abilities + Ability to travel up to 50% **Anticipated salary range** : $166,300 - 255,700 **Bonus eligible** : Yes **Benefits** : Cardinal Health offers a wide variety of benefits and programs to support health and well-being. + Medical, dental and vision coverage + Paid time off plan + Health savings account (HSA) + 401k savings plan + Access to wages before pay day with my FlexPay + Flexible spending accounts (FSAs) + Short- and long-term disability coverage + Work-Life resources + Paid parental leave + Healthy lifestyle programs **Application window anticipated to close** : 1/15/2026 *if interested in opportunity, please submit application as soon as possible. The salary range listed is an estimate. Pay at Cardinal Health is determined by multiple factors including, but not limited to, a candidate's geographical location, relevant education, experience and skills and an evaluation of internal pay equity. _Candidates who are back-to-work, people with disabilities, without a college degree, and Veterans are encouraged to apply._ _Cardinal Health supports an inclusive workplace that values diversity of thought, experience and background. We celebrate the power of our differences to create better solutions for our customers by ensuring employees can be their authentic selves each day. Cardinal Health is an Equal_ _Opportunity/Affirmative_ _Action employer. All qualified applicants will receive consideration for employment without regard to race, religion, color, national origin, ancestry, age, physical or mental disability, sex, sexual orientation, gender identity/expression, pregnancy, veteran status, marital status, creed, status with regard to public assistance, genetic status or any other status protected by federal, state or local law._ _To read and review this privacy notice click_ here (***************************************************************************************************************************
    $166.3k-255.7k yearly 2d ago
  • Business Insights Specialist (US)

    TDI 4.1company rating

    Business advisor job in Mount Laurel, NJ

    Hours: 40 Pay Details: $95,264 - $155,376 USD TD is committed to providing fair and equitable compensation opportunities to all colleagues. Growth opportunities and skill development are defining features of the colleague experience at TD. Our compensation policies and practices have been designed to allow colleagues to progress through the salary range over time as they progress in their role. The base pay actually offered may vary based upon the candidate's skills and experience, job-related knowledge, geographic location, and other specific business and organizational needs. As a candidate, you are encouraged to ask compensation related questions and have an open dialogue with your recruiter who can provide you more specific details for this role. Line of Business: Analytics, Insights, & Artificial Intelligence Job Description: Job Summary: The Business Insights Specialist is responsible for conducting analyses on curated and/or aggregated DataMart's in conjunction with deep business subject matter expertise, to generate relevant analytical insights for business issues and identify opportunities to drive business growth and value. This role works in partnership with business leaders to present or generate appropriate insights including the delivery of supporting collateral and/or presentations. Depth & Scope: Works autonomously and accountable for acting as a lead within a specialized business management function and may provide work direction to others Provides seasoned specialized knowledge, advice and/or guidance to various stakeholders and team members Scope of role may have enterprise impact Focuses on short to medium - term issues (e.g. 6-12 months) Undertakes and completes a variety of complex projects and initiatives requiring specialist knowledge and/or the integration of cross functional processes within own area of expertise Oversees and/or independently performs tasks from end-to-end May interact with any hierarchy level up to executive leaders and external vendors Education & Experience: Undergraduate degree or advanced technical degree preferred (e.g., math, physics, engineering, finance or computer science) Graduate's degree preferred with either progressive project work experience, or; 5+ year of relevant experience; higher degree education and research tenure can be counted Customer Accountabilities: Leads on the interpretation of complex business issues, generates multifaceted insights and identifies opportunities to help drive business growth or address business/enterprise needs Presents and communicates generated insights and recommended business actions to stakeholders/business leaders in an easily digestible manner, leveraging tools/techniques/methods to produce a variety of visualizations/presentations that fit the audience Acts as the primary interface with business to bridge and translate business requirements to analytics and reporting needs for a given domain/business Applies collaborative and strong stakeholder management approach to constructively influence and persuade stakeholders and partners where appropriate Serves as an authority on a given business domain and provides business expertise to place context around analytics discovery and inform recommendations Escalates data/process related problems and communicates to relevant teams in a timely manner and makes recommendations for resolution Provides day-to-day support and delivery of analytics Shareholder Accountabilities: Represents functional area as a business insights & analytics specialized expert Synthesizes complex and vast amount of information and translates into actionable insights and strategy Builds business requirements and facilitates project execution to develop insights Collaborates with partners on business challenges and delivers fact-based analytical advice that aligns to strategy and drives shareholder value Identifies opportunities for business growth within a specific business or function by identifying potential use cases and value drivers Utilizes both quantitative and qualitative methodologies to interpret and present data effectively and clearly Works directly with the business teams to gather the demand for analytics and work with the analytics hub to fulfill the analytics demand Provides business explanation for anomalies/outliers identified during analysis Works with business functions and analytics teams to transition business requirements to analytics requirements Trains business users on how to integrate analytics into decisions Leverages knowledge of data capabilities to build and deliver insights Develops analysis to corroborate initial proof of concept Executes on data requests accurately and within a timely manner Identifies and investigates data/analytics related issues Ensures business operations are in compliance with applicable internal and external requirements (e.g. financial controls, segregation of duties, transaction approvals and physical control of assets) Leads/facilitates and/or implements action/remediation plans to address performance/risk/governance issues Actively manages relationships within and across various business lines, corporate and/or control functions and ensures alignment with enterprise and/or regulatory requirements Keeps abreast of emerging issues, trends, and evolving regulatory requirements and assesses potential impacts Maintains a culture of risk management and control, supported by effective processes in alignment with risk appetite Employee/Team Accountabilities: Participates fully as a member of the team, supports a positive work environment that promotes service to the business, quality, innovation and teamwork and ensures timely communication of issues/points of interest Provides thought leadership and/or industry knowledge for own area of expertise in own area and participates in knowledge transfer within the team and business unit Keeps current on emerging trends/developments and grows knowledge of the business, related tools and techniques Participates in personal performance management and development activities, including cross training within own team Keeps others informed and up to date about the status/progress of projects and/or all relevant or useful information related to day-to-day activities Contributes to team development of skills and capabilities through mentorship of others, by sharing knowledge and experiences and leveraging best practices Leads, motivates and develops relationships with internal and external business partners/stakeholders to develop productive working relationships Contributes to a fair, positive and equitable environment that supports a diverse workforce Acts as a brand ambassador for your business area/function and the bank, both internally and/or externally Physical Requirements: Never: 0%; Occasional: 1-33%; Frequent: 34-66%; Continuous: 67-100% Domestic Travel - Occasional International Travel - Never Performing sedentary work - Continuous Performing multiple tasks - Continuous Operating standard office equipment - Continuous Responding quickly to sounds - Occasional Sitting - Continuous Standing - Occasional Walking - Occasional Moving safely in confined spaces - Occasional Lifting/Carrying (under 25 lbs.) - Occasional Lifting/Carrying (over 25 lbs.) - Never Squatting - Occasional Bending - Occasional Kneeling - Never Crawling - Never Climbing - Never Reaching overhead - Never Reaching forward - Occasional Pushing - Never Pulling - Never Twisting - Never Concentrating for long periods of time - Continuous Applying common sense to deal with problems involving standardized situations - Continuous Reading, writing and comprehending instructions - Continuous Adding, subtracting, multiplying and dividing - Continuous The above statements are intended to describe the general nature and level of work being performed by people assigned to this job. They are not intended to be an exhaustive list of all responsibilities, duties and skills required. The listed or specified responsibilities & duties are considered essential functions for ADA purposes. Who We Are: TD is one of the world's leading global financial institutions and is the fifth largest bank in North America by branches/stores. Every day, we deliver legendary customer experiences to over 27 million households and businesses in Canada, the United States and around the world. More than 95,000 TD colleagues bring their skills, talent, and creativity to the Bank, those we serve, and the economies we support. We are guided by our vision to Be the Better Bank and our purpose to enrich the lives of our customers, communities and colleagues. TD is deeply committed to being a leader in customer experience, that is why we believe that all colleagues, no matter where they work, are customer facing. As we build our business and deliver on our strategy, we are innovating to enhance the customer experience and build capabilities to shape the future of banking. Whether you've got years of banking experience or are just starting your career in financial services, we can help you realize your potential. Through regular leadership and development conversations to mentorship and training programs, we're here to support you towards your goals. As an organization, we keep growing - and so will you. Our Total Rewards Package Our Total Rewards package reflects the investments we make in our colleagues to help them and their families achieve their financial, physical and mental well-being goals. Total Rewards at TD includes base salary and variable compensation/incentive awards (e.g., eligibility for cash and/or equity incentive awards, generally through participation in an incentive plan) and several other key plans such as health and well-being benefits, savings and retirement programs, paid time off (including Vacation PTO, Flex PTO, and Holiday PTO), banking benefits and discounts, career development, and reward and recognition. Learn more Additional Information: We're delighted that you're considering building a career with TD. Through regular development conversations, training programs, and a competitive benefits plan, we're committed to providing the support our colleagues need to thrive both at work and at home. Colleague Development If you're interested in a specific career path or are looking to build certain skills, we want to help you succeed. You'll have regular career, development, and performance conversations with your manager, as well as access to an online learning platform and a variety of mentoring programs to help you unlock future opportunities. Whether you have a passion for helping customers and want to expand your experience, or you want to coach and inspire your colleagues, there are many different career paths within our organization at TD - and we're committed to helping you identify opportunities that support your goals. Training & Onboarding We will provide training and onboarding sessions to ensure that you've got everything you need to succeed in your new role. Interview Process We'll reach out to candidates of interest to schedule an interview. We do our best to communicate outcomes to all applicants by email or phone call. Accommodation TD Bank is an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, age, disability, status as a protected veteran or any other characteristic protected under applicable federal, state, or local law. If you are an applicant with a disability and need accommodations to complete the application process, please email TD Bank US Workplace Accommodations Program at ***************. Include your full name, best way to reach you and the accommodation needed to assist you with the applicant process.
    $95.3k-155.4k yearly Auto-Apply 9d ago
  • Microsoft Business Applications Sales Consultant

    Itc Worldwide 4.7company rating

    Business advisor job in Cherry Hill, NJ

    ITC WORLDWIDE is seeking a dynamic and experienced Microsoft Business Applications Senior Sales Consultant WFH or an ITC field office Are you passionate about selling business applications solutions that empower organizations to achieve more? Do you have a proven track record of delivering results in a complex and competitive market? Do you have experience with Microsoft Dynamics 365 Finance & Operations or other ERP systems? If so, we want to hear from you. To be successful in this position you will possess the following attributes: Motivated and proactive professional with previous experience in end-to-end sales within Microsoft or equivalent Enterprise Applications. 5+ years face-to-face selling experience - Microsoft product suite expertise including D365, PowerApps and Business Central is highly regarded. Demonstrated ability to hunt new business opportunities. Ability to build and foster strong customer relationships in existing customer base. A strong customer-centric approach and ability to network across a complex organization. Skills in managing multiple commercial processes (new business sales), forecasting precisely and identifying challenges to positive commercial outcomes. Develop and execute a sales strategy in designated territories and work with both vendor and Industry teams to execute. Arrange and conduct customer meetings, serve as trusted advisor by understanding a customer's existing and future digital transformation roadmap and driving the sales. Strong networking skills and industry experience Ability to drive new business and get engaged with lead generation. Liaising with solution consultants to drive correct business outcomes. Desire to be involved in a rapidly growing business and take a leadership role in helping it thrive. Strong personality motivated by continual improvement and self-development Responsibilities: Develop and execute sales strategies to grow revenue and market share in the Finance & Operations segment. Build and maintain strong relationships with key decision makers and influencers across various industries and geographies. Understand customer needs and pain points and propose value-added solutions that leverage Microsoft's D365 platforms and applications. Collaborate with delivery and pre-sales teams to ensure proposed solutions align with client requirements. Working with Marketing and Business Development personnel to help develop lead generation campaigns along with target marketing to specific verticals. · Manage the entire sales cycle, including prospecting, negotiations, and contracting Develop and nurture a robust pipeline of prospects to achieve and exceed sales targets Leverage your sales knowledge and existing Microsoft ecosystem network Qualifications: Minimum of 5 years of experience in selling enterprise software solutions, preferably in the ERP domain Strong knowledge of Microsoft Dynamics 365 Finance & Operations or other ERP systems and their business benefits Excellent communication, presentation, and negotiation skills Ability to work independently and as part of a team in a fast-paced and dynamic environment. Bachelor's degree in business, finance, or related field Prior consulting services sales experience required, and an understanding of Microsoft's Business Applications preferred (Sales, Service, Marketing, Finance, HR, Supply Chain, and Project Operations) Package Details Contract W2 role for an experienced Tech Seller! Base Salary (Draw) W2 Commissioned: from 1-3% on lifetime Support + Bonus on Managed Services +Cash Bonus What's in it for you Qualified Leads Technical Sales & Service Support Product Selling Training Provided Dynamics 365 - CRM Dynamics 365 - Business Central Microsoft 365 ISV Solutions (Offers) Neural Impact Sales Optimization Training Differentiation & Engagement Effective Discovery & CIO Engagement Project Impact & Objection Handling $ 150,000.00 (US Dollar) BIzzApp Sales 2. Acct exec 3. services & support consult
    $150k yearly 60d+ ago
  • INTERN - Field Service Quality Business & Data Analytics

    Subaru 4.8company rating

    Business advisor job in Camden, NJ

    Subaru of America, Inc.'s Internship Program provides a valuable opportunity for students to gain real-world experience related to their major. Interns have the chance to work on meaningful projects, collaborate with professionals, and develop skills that will be beneficial in their future careers. It's an excellent way to jump-start their career and enhance their skillset, making them more marketable in their field of study. The Advanced Quality Assurance internship is for students pursing a Bachelor's Degree with a major in Automotive Industry Management, Business Management, Business Analytics, or Project Management. Course of Study Pursing a bachelor's degree or MBA with major in Automotive Industry Management, Business Management, Business Analytics, or Project Management Term 1 year in length [37.5 hours per week during the summer; ~18-25 hours per week during school year] Internship to begin in May and end the following May Location - Subaru Headquarters in Camden, NJ $20 an hour (undergrad) Qualifications Current Juniors OR Seniors planning to pursue a Master's Degree OR students currently enrolled in a Master's Program (expected graduation date between 5/2027 and 12/2027) Must be an active student for the entire length of internship Previous internship or work experience preferred Skills Excellent interpersonal and communication skills Ability to work both independently and in a team environment Passion and basic knowledge or capacity to learn about automobiles and the industry Business and data analytical skills a must Proficient in Microsoft Office (Excel, Word, PowerPoint) Must be able to handle multiple projects and competing deadlines Working knowledge of Power BI and Power Automate a plus. Responsibilities Gather and compile data from multiple systems to create district composite reports for designated (East, Central, West) region Service Quality Managers (47 total district managers) on a weekly basis Special ad-hoc assignments requiring creativity and heavy analytical skills, MS suite expertise (especially Excel and Power Point) Assist in the research, preparation, production, and delivery of departmental presentations Assist in analyzing performance of automotive safety recall completion data Research warranty trends and analyze automotive safety recall process deviation Assist in the preparation of presentations and meetings (i.e., Inter-departmental presentations, training sessions, and others) Assist with warranty pre-authorization processing SUMMARY Subaru of America's Field Service Quality department is a fast-paced and exciting environment that provides an opportunity to experience business operations on a local and national level. This position supports the District Service Quality Team, with reporting and analysis, and provides visibility throughout all areas and levels of the organization. Research and deliverables must be accurate and consistent. The ideal candidate would be able to understand the big picture without losing attention to detail. Creative thinking, analysis, content production, and intermediate automotive skills are a plus.
    $20 hourly Auto-Apply 29d ago
  • SAP FI Treasury Business Process Consultant

    Cygnus Professionals 3.2company rating

    Business advisor job in Middletown, PA

    Headquartered in New Jersey (U.S), Cygnus Professionals Inc. is a next generation global information technology Solution and Consulting company powered by strong management and leadership team with over 30 person years of experience. Today, Cygnus has strong footprints in more than 4 countries with more than 25 satisfied customers. We strive to extend our presence across industries and geographies with our industry-focused business excellence. Cygnus Professionals Inc. has been named by the US Pan Asian American Chamber of Commerce Education Foundation (USPAACC) as one of the “Fast 100 Asian American Businesses” - joining the country's fastest-growing Asian American-owned companies, based on percentage revenue growth over the immediate past two years. Job Description SAP FI Treasury Business Process Consultant Middletown, PA 6-12 Months Contract Phone + Skype Qualifications 10+ years of expertise in the following SAP Modules: Finance (FI) Treasury (Investment Management, Cash Management, Debt Management) Recent project(s) must have involved working with Treasury module Controlling (CO) At least 1 recent project working in the public sector Expertise in as many of the following SAP modules as possible: Funds Management (FM) Financial Accounting (FA) General Ledger (GL) Accounts Payable (AP) Accounts Receivable (AR) Fixed Assets (FA) Budgeting & Forecasting Banking Projects Systems (PS) Plant Maintenance (PM) Materials Management (MM) Supplier Relationship Management (SRM) Human Capital Management including Payroll (HCM) Experience performing the following functions/tasks with SAP Treasury modules: Configuration & maintenance Identifying and correcting configuration issues Providing support & training to end users Supporting integration of Treasury & FICO modules with other SAP modules Additional Information Agile Systems/RWD uPerform ServiceNow Quality Center Panaya Standard SaaS - SAP Support Pack Automation & Test Management w/HP Quality Center Integration
    $78k-119k yearly est. 60d+ ago
  • Infor Presales Business Consultant

    Tata Consulting Services 4.3company rating

    Business advisor job in Edison, NJ

    About the Job * Expert in Infor ERP application * Experience of handling the complete sales cycle & driving closure * Driving the complete RFP cycle * Experience to assess and identify customer objectives and build upon these with winning customer centric solutions and sales themes * Experience of designing the overall solution theme for the RFP response * Respond to RFPs and technical queries during the sales process * Writing RFP responses & preparing effort estimations * Working with the Client Partners & customers to identify white spaces within the customer landscape & provide solutions from Infor bouquet * Excellent Documentation & Presentation Skills * Deliver compelling product demos and presentations to executives and end-users * Attending meetings, delivering capability & proposal presentations * Experience of dealing with CXO level * In-depth knowledge of ERP implementation (preferably Infor ERP like LN or M3) * Own the revenue target Qualifications: * Engineering * MBA * 13-15 years of experience * 50%-60% travel Salary range: $131,419 - $181,591 a year #LI-MG2
    $131.4k-181.6k yearly 7d ago
  • Business Development

    Quaker Mechanical

    Business advisor job in Riverton, NJ

    Job DescriptionBusiness Development - Commercial HVAC (Union Market) Company: Quaker Mechanical Employment Type: Independent Contractor (1099) - Commission OnlyAbout Us Quaker Mechanical is a leading commercial HVAC contractor specializing in union projects. With a reputation for excellence, we deliver top-tier mechanical solutions in the union HVAC marketplace across the Cinnaminson area and beyond. Position Overview We're seeking a driven Business Development professional with a solid background in commercial construction sales within the union HVAC market. This is a 1099, commission- only opportunity designed for self-starting individuals eager to grow their income based on performance. Key Responsibilities Cultivate and maintain relationships with general contractors, developers, and union contacts. Identify and pursue new project opportunities in commercial HVAC. Negotiate and close deals aligned with company capacity and goals. Collaborate with internal teams (estimating, operations) to transition new projects smoothly. Provide market insights and strategic growth recommendations. Qualifications 2+ years of experience in commercial construction sales, with a focus on union HVAC. Familiarity with the union HVAC landscape and strong industry contacts. Excellent negotiation, communication, and relationship-building skills. Ability to work independently in a commission-based, 1099 role. Compensation Structure (Commission + Stipends) This role offers uncapped earning potential through a tiered commission on gross profit, plus fixed monthly stipends: 0.5% on $0 - $100,000 Contract amount 1.0% on $101,000 - $500,000 Contract amount 1.5% on $501,000 - $750,000 Contract amount 2.0% on $751,000 and above Contract amount $100/month cell phone stipend $300/month auto stipend
    $76k-120k yearly est. 2d ago
  • Sr. Business Consultant - Outside Sales

    Alcott HR 3.4company rating

    Business advisor job in Philadelphia, PA

    Alcott HR is seeking an experienced Outside Sales professional to join our team as a Senior Business Consultant. As a Professional Employer Organization, we offer comprehensive Human Resources support to our clients. In this role, you will spearhead the launch of our services in the Philadelphia market, serving as the primary sales representative. Your main responsibilities will include identifying potential business opportunities, fostering strong relationships throughout the area, and engaging with potential clients to understand their needs. You will work closely with business owners and key decision-makers to provide tailored HR solutions. We've got a lot to offer: Uncapped commission and unlimited territory Ability to sell any of our offerings to any industry (PEO, ASO, HRO, HR Consulting) Competitive base salary plus an industry-leading commission plan with escalating rates Remote schedule Here's what you'll do: Develop and maintain relationships with business owners and key decision makers. Leverage your professional network to generate referral business and expand Alcott HR's client base Network with business advisors to educate them on Alcott HR's offerings and benefits for their clients Prospect and network for business owners and key decision makers to explain how Alcott HR can help their company to grow Complete required sales process, paperwork and finalize new client contracts Travel throughout our open territory. No set territories with Alcott HR! Exceed sales goals determined by management, and reach your maximum earning potential You are someone who has: 2+ years of business-to-business sales experience with a focus on relationship-building Successful and stable track record of excellence Ability to aggressively prospect for new business A positive and consultative mindset when engaging with clients Exceptional verbal and written communication abilities, particularly with C-level executives Ability to work independently, as well as being a collaborative team member Expertise in consultative and solution-oriented sales techniques A driven, self-starter attitude with strong time management skills We definitely want to talk to you if you have the following: Demonstrated ability in cold calling and prospecting with a positive and persistent style Proven ability to be a "hunter gatherer" within the C-level market PEO and/or Employee Benefit sales experience We know you have your choice of roles for your next opportunity. Here's why we think you should choose Alcott HR: You'll be joining a PEO & HR company that is poised for rapid growth, taking a new and exciting service model and message to underserved markets across the US. We have a big market to go after, striving to provide the best and most unique HR service in the space, and some of the most loyal and enthusiastic clients behind us. Big Enough to Get the Job Done, Small Enough to Care. Family working environment with the ability to influence executive decision making and help steer the ship. Compensation: Base Salary of $70,000-$85,000 plus commission structure, enabling a potential total earning potential of $105,000-$185,000+ About Alcott HR At Alcott HR, we have a Passion for People and Performance™. We empower leaders to focus on their core business purposes and meaning which enables them to more quickly and efficiently grow their business. Alcott HR provides clients and business owners with customized solutions for running their business, including HR best practices, regulatory compliance, payroll, training and development, employee benefits, risk management support, workers' compensation insurance and employment related administration. We serve a diverse group of successful profit and not for profit businesses across the U.S. Get to know us by visiting ***************** Alcott HR provides equal employment opportunities (EEO) to all employees and applicants for employment without regard to race, color, religion, sex, national origin, age, disability or genetics. In addition to federal law requirements, Alcott HR complies with applicable state and local laws governing nondiscrimination in employment in every location in which the company has facilities.
    $105k-185k yearly 1d ago
  • J.P. Morgan Wealth Management - Vice President, Business Development Consultant - Cherry Hill, NJ

    Jpmorganchase 4.8company rating

    Business advisor job in Cherry Hill, NJ

    Shape the future of wealth management by driving innovation and growth at J.P. Morgan. Be at the heart of launching strategic initiatives, empowering teams, and making a lasting impact on our clients and organization. Unlock your potential and help set new standards in financial services. As the Business Development Support Manager within J.P. Morgan Wealth Management, you are responsible for executing strategic business initiatives and ensuring the successful rollout of new products, services, and processes across the organization. This role acts as a bridge between business development, sales, product, and operations teams, driving project delivery and supporting field adoption to achieve growth objectives. Job Responsibilities Execute the implementation of new business development strategies, products, and services to Financial Advisors and Field Leaders in collaboration with cross-functional teams. Manage timelines, and deliverables for field execution. Coordinate and lead training and support for sales and support teams to ensure effective adoption of new technology, practice management and business development supporting an Advisor's practice. Monitor progress, identify risks, and resolve issues that arise during implementation. Collect and analyze feedback from field teams and clients to inform continuous improvement. Foster strong relationships with internal stakeholders and external partners to facilitate successful implementation. Required qualifications, skills, and capabilities Bachelor's degree in Business, Finance, or related field 7 + years of experience in business development, project management, sales management or implementation roles within financial services. Proven track record of managing complex projects and cross-functional teams. Strong organizational, analytical, and problem-solving skills. Excellent communication, presentation and stakeholder management abilities. Knowledge of financial products, services, and regulatory requirements. Experience in coaching Advisors or a sales team Travel required 50% of the time Required Licensing A valid and active Series 7 license is required or may be obtained within a 60-day condition of employment If you were registered after October 1, 2018, you must also have a valid and active Securities Industry Essential (SIE) exam A valid and active Series 66 (63/65), and Life and Health Insurance license must be obtained within 60 days of starting in the role as a condition of employment Skills Executive presentation and communication skills Change management Cross-functional collaboration Data analysis and reporting Training and facilitation INVESTMENT AND INSURANCE PRODUCTS ARE: NOT FDIC INSURED • NOT INSURED BY ANY FEDERAL GOVERNMENT AGENCY • NOT A DEPOSIT OR OTHER OBLIGATION OF, OR GUARANTEED BY, JPMORGAN CHASE BANK, N.A. OR ANY OF ITS AFFILIATES • SUBJECT TO INVESTMENT RISKS, INCLUDING POSSIBLE LOSS OF THE PRINCIPAL AMOUNT INVESTED Investment products and services are offered through J.P. Morgan Securities LLC (JPMS), a registered broker-dealer and investment advisor, member of FINRA and SIPC. Annuities are made available through Chase Insurance Agency, Inc. (CIA), a licensed insurance agency, doing business as Chase Insurance Agency Services, Inc. in Florida. JPMS, CIA and JPMorgan Chase Bank, N.A. are affiliated companies under the common control of JPMorgan Chase & Co. Products not available in all states.
    $136k-187k yearly est. Auto-Apply 8d ago
  • Automotive Business Consultant - Accounting Specialist

    Reynolds and Reynolds Company 4.3company rating

    Business advisor job in Philadelphia, PA

    . Must be willing to travel, with overnight hotel stays, up to 5 nights per week (every week). Reynolds and Reynolds is looking for experienced automotive professionals to join our consulting team. Our superior software solutions, our award-winning sales, service, and support have made us one of the most recognized and respected companies in the automotive industry. As an Automotive Business Consultant your primary focus will be to establish professional relationships with customers and help their businesses become more efficient, effective, and profitable. You will work with dealership personnel to identify trouble areas within the dealership and then use established and proven consulting services programs, as well as your industry knowledge, to help solve these issues. Once a project is complete, you will follow-up with customers to maintain relationships and provide ongoing 'fee for service' support and problem resolution. By helping these customers become successful in the different areas of the dealership, you will build trust that will further drive consulting services sales. If you are looking for an opportunity to utilize your automotive skills and make a difference for automotive dealerships across the country, please apply today!","job_category":"Consulting","job_state":"PA","job_title":"Automotive Business Consultant - Accounting Specialist","date":"2025-12-05","zip":"19019","position_type":"Full-Time","salary_max":"80,000. 00","salary_min":"60,000. 00","requirements":"High School Diploma or equivalent; Bachelor's preferred but not required~^~5+ years of automotive dealership experience (Office Manager, controller(automotive accounting), and AP\/AR Accounting Representative)~^~Must be willing to travel extensively with overnight hotel stays up to 5 nights per week (every week). ~^~Must have reliable transportation as well as a valid driver's license, with fewer than 2 moving violations in the last three years and no OVI\/DUI\/DWI violations in the last five years. ~^~Must have reliable home internet with sufficient bandwidth for video conferencing~^~Experience with Reynolds and Reynolds accounting software is highly preferred","training":"Our training consists of time with experienced consulting and sales representatives in the field for approximately 90 days, online courses completed in your home office, and classroom instruction through our offices in Dayton and Houston. Your compensation during training will be a $60,000-63,000 base salary. You will be eligible for quarterly bonuses after the 9 month training period. Total targeted income after training (including base and bonuses) is $80,000+. ","benefits":"We strive to offer an environment that provides our associates with the right balance between work and family. We offer a comprehensive benefits package including: - Medical, dental, vision, life insurance, and a health savings account - 401(k) with up to 6% matching - Paid vacation and sick days - Eight paid holidays - Referral bonuses - Professional development and training - Promotion from within Reynolds and Reynolds promotes a healthy lifestyle by providing a non-smoking environment. Reynolds and Reynolds is an equal opportunity employer. ","
    $60k-63k yearly 11d ago
  • Business Development

    Coretitle

    Business advisor job in Mount Laurel, NJ

    CORE is currently seeking a hardworking and experienced Title Insurance Sales Representative. Join one of South Jersey's fastest growing title companies and most successful title team! Whether you have a well-established client base or need help taking your business to the next level, we want to meet. Increase overall resale and refinance market share in the New Jersey and Pennsylvania market by building strong relationships with REALTORS, mortgage brokers and loan originators, banks, credit unions. Team player who acts as the liaison between the inside office staff and clients in the field. Must be confident in making cold calls, prospecting for leads, as well as maintaining current customer's needs. Strong social media presence is a plus. Develop and initiate new sales and marketing ideas. Actively pursue office presentations with office brokers and staff Knowledge of real estate business is extremely helpful. Consistently increase business and revenues Candidate must possess the following: Strong work ethic. Must provide own reliable transportation. Superior time management skills OTHER REQUIREMENTS: Attending outside functions both during the day and some evenings Excellent interpersonal communication skills (both written and verbal) Ability to effectively present information one-on-one and in group settings Maintain a professional appearance and providing a positive company image EDUCATION: Minimum High School or equivalent (required) Degree in Sales and Marketing (preferred) EXPERIENCE: 2-5 years of successful sales experience in the Real Estate industry Salary is commensurate with experience Job Type: Full-time
    $76k-120k yearly est. 60d+ ago
  • Landscape Business Development - South Jersey

    Gras Lawn

    Business advisor job in Beverly, NJ

    Job DescriptionSalary: Gras Lawn, a commercial landscape company, is seeking an experienced Landscape Business Developer for the South Jersey Market. Your main responsibility is developing business with potential new customers, building and maintaining trusted relationships with key decision-makers, understanding their challenges, and creating value solutions. Your role also involves effectively identifying opportunities, gathering valuable intelligence, creating customer-centric proposals, collaborating with team members, meeting specific activity targets, and closing deals. The Business Developer focuses on strengthening Gras Lawns market presence and driving profitable growth. This position plays a key role in meeting long-term strategic objectives by fostering important customer relationships, identifying business opportunities, negotiating and closing deals, and maintaining a comprehensive understanding of the current market landscape. Identifyandunderstandthechallengesofprospectiveclientsanddevelopsolutions. Provideaccurateforecastsforsales,deliverables,andkeyperformanceindicators(KPIs). Achievesalesgoalswhilehavingtheabilitytoworkindependently. Usesalestechniquestofindnewcustomersandbuildlong-termbusinessrelationships.Also,focusonmarketingandpricingstrategies. Conductphoneprospecting,salespresentations,virtualdemonstrations,andcontractnegotiationswithminimalsupervision. Identifycustomerneedsandapplysolution-basedsellingtechniquestodemonstratethevalueof GrasLawnsserviceseffectively. Buildandnurturerelationshipswithpotentialandcurrentclients. Planyourdailyactivitiesandaimtomeetspecificperformancebenchmarkstoclosebusinessdealssuccessfully. ConsistentlyandreliablylogactivitiesintheCRM. Workeffectivelyinafast-pacedenvironmentwhilemaintainingastrongsenseofurgency. Communicateproactivelywithallclients,prospects,andcolleagues. SkillsRequired: ExtensiveexperienceintheCommercialLandscapeIndustry Proventrackrecordofsalesgoalattainmentandpipelinemanagement 3-5yearsofexperienceinB2Bsalesatmid-to-seniorlevels. Localknowledgeandcontactsinoneormoremarketsegments Proficientwithcomputerprograms,including AspireandaCRMtool Highlycompetitive,positive,andresults-driven Exceptionalmultitasker. Excellentoralandwrittencommunicationabilities,strongpresentationskills,andprofessionalexperiencewithsocialmedia. Passionate,organized,andresourcefulindividualwithoutstandinglisteningandinterpersonalskills. Highly organized, self-motivated, and hardworking, with effective time management capabilities. Easilyadaptabletonewsituations. Salary commensurate with experience. Youwillberesponsiblefor: TheBusinessDeveloperoverseesthesalespipelinefromtheprospectingstagetoclosingandisaccountablefortheentiresalescycle,includingsnowsalesincertainregions.Additionally,the BusinessDeveloperworksincollaborationwithpartnersacrossoperations,finance,marketing,andotherdepartmentstoeffectivelyrespondtobidsandachievesalesgoals. Salary commensurate with experience.
    $76k-120k yearly est. 7d ago
  • Managing Consultant, Air Quality

    Ramboll 4.6company rating

    Business advisor job in Blue Bell, PA

    Founded in Denmark, Ramboll is a foundation-owned people company. We have more than 18,000 experts working across our global operations in 35 countries with thousands of experts working across 70 offices in the Americas. Our experts are leaders in their fields, developing and delivering innovative solutions in diverse markets including Buildings, Transport, Planning & Urban Design, Water, Environment & Health, Energy, and Management Consulting. We invite you to contribute to a more sustainable future working in an open, collaborative, and empowering company. Combining local experience with global knowledge, we together shape the societies of tomorrow. Job Description Preferred job location: Albany, NY, USA. Other locations include Syracuse NY; Rochester, NY; or Blue Bell, PA. Are you eager to develop your excellence in an inclusive, collaborative, and empowering community? Are you excited about joining a company that strives to make a difference - for its employees, clients, and society? Are you motivated by creating sustainable change that benefits society and nature? If this sounds interesting to you, or you're curious to learn more, then this role could be the perfect opportunity for you. Join our team and work with us to close the gap to a sustainable future. Your new role As our new Managing Consultant with air quality compliance & permitting consulting experience, you will be part of Ramboll's Environment & Health Division. This group consists of people who are passionate about air quality, and other environmental regulatory compliance, while assisting Ramboll's clients with their most challenging problems. The services and support provided to our clients within various industries range across a variety of topics, including but not limited to air permit applications, emissions estimation, preparation of air compliance related reports, air dispersion modeling, and general regulatory compliance. Your key tasks and responsibilities will be: Critically reviewing and interpreting local, state, and federal environmental regulations, with focus on air compliance Maintaining client relationships and managing the development of deliverables to meet client needs in an efficient manner Serving as the technical lead overseeing Consultant-level staff on complex projects Estimating emissions and conducting engineering evaluations of air pollution sources Supporting air dispersion modeling of air pollution dispersion Preparing all levels of air quality permit applications and environmental reports EPCRA Tier II and TRI Reporting Other environmental regulatory compliance experience consider a plus Your new team As part of the team, you will be part of a creative group, filled with people who are really excited about solving clients' problems and creating sustainable solutions for them. You will work with all levels of technical expertise from entry level team members to members with decades of experience, many of whom are subject matter experts in their own fields. And you will engage in a continual learning environment through coaching, mentoring, and on the job tasks. About you From the moment you join Ramboll, we will support your personal and professional development so that you grow with the company. For this role, we believe your starting point is: B.S. or M.S. in Chemical, Mechanical, Civil, or Environmental Engineering or science discipline (air quality course work is a plus) 9+ years of air quality related experience Strong computing skills including high level use of spreadsheets and word processing Strong written/verbal communication, problem-solving and organization skills Demonstrated capabilities in understanding, interpreting, and applying environmental regulations to real-world situations Programming, database and GIS skills are preferred but not required What we can offer you Interesting and diverse projects The opportunity to work with some of the best and brightest professionals in your field Flexible work arrangements Generous Paid Time Off Excellent health and retirement benefits Investment in your development Leaders you can count on, guided by our Leadership Principles Appreciation for the unique person you are The long-term thinking of a foundation-owned company Inspiration from colleagues, clients, and projects Salary Transparency Statement At Ramboll, your base pay is only part of your overall total compensation package. At the time of this posting, this role is likely to be compensated at an annual base salary in the New York area between $114,000 and $143,000. Actual pay may be more or less than the posted range, depending on numerous factors, including experience, geographical location, internal equity, market conditions, education/training and skill level, and does not include bonuses, overtime, or other forms of compensation or benefits. Work at the heart of sustainable change Ramboll is a global architecture, engineering, and consultancy company. We believe that the purpose of sustainable change is to create a thriving world for both nature and people. So, that's where we start - and how we work. At Ramboll, our core strength is our people, and our history is rooted in a clear vision of how a responsible company should act. Being open and curious is a cornerstone of our culture. We embrace an inclusive mindset that looks for fresh, diverse, and innovative perspectives. We respect, embrace, and invite diversity in all forms to actively cultivate an environment where everyone can flourish and realize their full potential. Ready to join us? Please submit your application. Be sure to include all relevant documents including your CV and a cover letter connecting your background to the responsibilities of the position. Please note, applicants must be currently authorized to work in the United States on a full-time basis. No sponsorship is available for this position. We recognize that some candidates only apply when they tick every box. However, passion and potential often outweigh a perfect resume and Ramboll's supportive learning culture can help you grow. So, if this role resonates with you but you don't meet all the requirements, we encourage you to apply. You might be the perfect fit for this opportunity or another within our team. Thank you for taking the time to apply, we look forward to receiving your application! An equal opportunity employer Equality, diversity, and inclusion is at the heart of what we do. At Ramboll, we believe that diversity is a strength, and that different experiences and perspectives are essential to creating truly sustainable societies. We invite applications from candidates of all backgrounds, regardless of age, disability or medical condition, gender identity, marriage and domestic partnership, pregnancy and maternity, race, ancestry, or national origin, religion or belief, sex and sexual orientation, military service and veteran status, or any other protected characteristic Additional Information All your information will be kept confidential according to EEO guidelines.
    $114k-143k yearly 19h ago
  • Business Developer (Civil Engineering / Pavement Technology)

    NIRA Dynamics Inc.

    Business advisor job in Ambler, PA

    Job DescriptionBenefits: 401(k) Competitive salary Dental insurance Health insurance Opportunity for advancement Paid time off About Us NIRA Dynamics is a global leader in road-condition analytics using standard vehicles as sensors. Our technology is used by road authorities, automotive OEMs, telematics partners, and infrastructure operators across Europe and North America. With the rapidly growing U.S. market, we are expanding our team to support a new wave of customers and cutting-edge product development. Position Overview We are seeking a Solution Architect with a strong background in civil engineering, pavement technology, and data-driven road management. This role sits at the intersection of sales, development, and customer success, ensuring U.S. customers receive frictionless onboarding, powerful insights, and continuous product value. You will help shape how our products evolve in the U.S. markettranslating customer needs into actionable development tasks, analyzing and delivering data, and supporting both internal teams and external partners. Key Responsibilities Work closely with the both the Sales and the Development teams to support all U.S. customer-facing operations. Lead onboarding for new U.S. customers and provide technical guidance through implementation. Gather customer requirements and communicate them clearly to the development team. Deliver data packages, insights, and visualizations that support customer use cases. Attend meetings, demos, and industry conferences as the technical representative. Analyze existing and incoming datasets to enhance or design new service offerings. Design, plan, and develop new services in collaboration with Product & Development. Support customer integrations and contribute to documentation and best practices. Continuously improve and maintain existing services. Career Path Opportunities You may grow toward: 1. Technical Expert Path Become a high-level translator between customers and developers turning real-world road problems into technical specifications and product improvements. 2. Customer-Facing Path Expand into a hybrid role combining Solution Architecture, Sales Support, and Customer Success, becoming a trusted advisor for DOTs, agencies, and automotive partners. Required Qualifications Education Bachelors degree in Civil Engineering or a related discipline. Work Experience 5+ years in road management, pavement technology, or an equivalent field. Experience with data analysis, data mining, and interpreting road/vehicle sensor datasets. Knowledge & Skills Sales, CRM, or customer-facing technical experience. Basic Python and SQL skills. Expert knowledge of pavement technology and road condition monitoring. Experience with road monitoring or pavement equipment/systems. Fluent in English. Preferred Qualifications Doctorate related to civil engineering. Experience working for a DOT, federal agency, or road management technology company. Publications (articles, white papers, research). Agile development experience. Skills in Java, CI/CD, React with Typescript. Project management experience. Product development experience. Personal Attributes Curious and investigative mindset Passion for pavement and infrastructure innovation Strong initiative and independence Excellent communication and collaboration skills Business-minded and customer-oriented Adaptive and problem-solving oriented Socially competent and receptive to feedback Works effectively in small, fast-moving teams
    $84k-133k yearly est. 10d ago

Learn more about business advisor jobs

How much does a business advisor earn in Hamilton, NJ?

The average business advisor in Hamilton, NJ earns between $79,000 and $175,000 annually. This compares to the national average business advisor range of $67,000 to $138,000.

Average business advisor salary in Hamilton, NJ

$117,000

What are the biggest employers of Business Advisors in Hamilton, NJ?

The biggest employers of Business Advisors in Hamilton, NJ are:
  1. Cigna
Job type you want
Full Time
Part Time
Internship
Temporary