Post job

Business advisor jobs in Lakewood, NJ

- 571 jobs
All
Business Advisor
Business Specialist
Vice President, Business Development
Senior Management Consultant
Business Development Associate
Business Developer
Management Consultant
Business Internship
Business Process Consultant
Business Associate
Senior Business Consultant
Business Consultant
Business Development Internship
Senior Advisor
  • Senior Management Consultant-Retail

    Fractal 4.2company rating

    Business advisor job in Burlington, NJ

    Senior Management Consultant- Retail ****Philadelphia, New Jersey or New York area and can commute to the client office Fractal is a strategic AI partner to Fortune 500 companies with a vision to power every human decision in the enterprise. Fractal is building a world where individual choices, freedom, and diversity are the greatest assets. An ecosystem where human imagination is at the heart of every decision. Where no possibility is written off, only challenged to get better. We believe that a true Fractalite is the one who empowers imagination with intelligence. Fractal has been featured as a Great Place to Work by The Economic Times in partnership with the Great Place to Work Institute and recognized as a ‘Cool Vendor' and a ‘Vendor to Watch' by Gartner. Please visit Fractal | Intelligence for Imagination for more information about Fractal. Job Description We are looking for a Senior Decision Scientist in Retail, who is proficient with analytics consulting and solving complex business problems in the world of retail, particularly store operations, asset protection, merchandising and strategy. Solve business problems using data-driven models (75%) Take business problem and build structured analytical approaches to solving, inclusive of identifying needed data, analysis required, and strategy for synthesizing and presenting the analysis results Design and build analytical solutions to enable recurring analysis of business performance Effectively scope, size, and plan the development of analytical solutions and set expectations accordingly Translate high level business problems into discrete questions that can be answered by using data-driven models Identify opportunities to improve business performance through use of analytical approaches Translate output of models into recommendations for how the business can operate differently Collaborative Relationships (25%) • Develop and maintain effective working relationships with members of cross-functional teams. • Create a strong partnership with all areas of the organization that require interaction. • Partner with stakeholders to drive implementation of recommendations from analysis • Keep individual, division, and total company goals in mind when making decisions. • Demonstrate and utilize strong communication skills in all interactions. Education: Bachelor's Degree with quantitative coursework (degree in math, science or relevant field); having an MBA is preferred but not required Experience: 3-5 years of experience in analytics, management consulting, or merchandise planning is preferred Experience with Statistical Analysis is preferred Skills and Abilities: Excellent interpersonal, communication and organization skills. Self-motivated, collaborative, with the desire to learn Excellent communication skills and ability to interact with all levels Highly strategic with an ability to take initiative, multi-task, and prioritize projects successfully to meet deadlines Strong project management skills and ability to collaborate productively with many departments Microsoft Office (Excel, Word, PowerPoint) proficiency with clear storyboarding and data handling skills Strong sense of business/retail math with working knowledge of statistical models like Regression/Clustering and Hypothesis Testing Strong analytical skills with the ability to collect, organize, analyze, and disseminate significant amounts of information with attention to detail and accuracy Working knowledge of R/Python for statistical modelling Pay: The wage range for this role takes into account the wide range of factors that are considered in making compensation decisions, including but not limited to skill sets; experience and training; licensure and certifications; and other business and organizational needs. The disclosed range estimate has not been adjusted for the applicable geographic differential associated with the location at which the position may be filled.At Fractal, it is not typical for an individual to be hired at or near the top of the range for their role and compensation decisions are dependent on the facts and circumstances of each case.A reasonable estimate of the current range is: $120,000 - $159,000. In addition, you may be eligible for a discretionary bonus for the current performance period. Benefits: As a full-time employee of the company or as an hourly employee working more than 30 hours per week, you will be eligible to participate in the health, dental, vision, life insurance, and disability plans in accordance with the plan documents, which may be amended from time to time. You will be eligible for benefits on the first day of employment with the Company. In addition, you are eligible to participate in the Company 401(k) Plan after 30 days of employment, in accordance with the applicable plan terms. The Company provides for 11 paid holidays and 12 weeks of Parental Leave. We also follow a “free time” PTO policy, allowing you the flexibility to take the time needed for either sick time or vacation. Fractal provides equal employment opportunities to all employees and applicants for employment and prohibits discrimination and harassment of any type without regard to race, color, religion, age, sex, national origin, disability status, genetics, protected veteran status, sexual orientation, gender identity or expression, or any other characteristic protected by federal, state or local laws
    $120k-159k yearly 1d ago
  • Vice President and Head of Business Development

    Systimmune, Inc.

    Business advisor job in Princeton, NJ

    SystImmune is a leading and well-funded clinical-stage biopharmaceutical company located in Redmond, WA and Princeton, NJ. It specializes in developing innovative cancer treatments using its established drug development platforms, focusing on bi-specific, multi-specific antibodies, and antibody-drug conjugates (ADCs). SystImmune has multiple assets in various stages of clinical trials for solid tumor and hematologic indications. Alongside ongoing clinical trials. SystImmune has a robust preclinical pipeline of potential cancer therapeutics in the discover and IND-enabling stages, representing cutting-edge biologics development. We offer an opportunity for you to learn and grow while making significant contributions to the company's success. As the Vice President and Head of Business Development, you will be a key driver in shaping SystImmune's growth trajectory. Your strategic vision, leadership, and ability to develop our portfolio strategy and forge impactful partnerships will directly impact our clinical asset progress. This role combines business acumen, scientific understanding, and team management to unlock the full potential of our technology platforms and pipeline. You will report directly to the CEO and partner closely with R&D, Finance, and Manufacturing both at SystImmune and its affiliate in China. Key Responsibilities * Business Development Strategy * Develop and execute a comprehensive business development strategy aligned with SystImmune's scientific, strategic, and financing plans. * Identify licensing, partnership, and collaboration opportunities to accelerate clinical asset development. * Collaborate closely with the scientific team to define and deliver key data packages and lead all scientific due diligence process by potential partners. * Develop proposed deal architecture and terms, and lead negotiations of term sheets and agreements with potential partners in collaboration with legal and finance. * Commercial assessment, competitive landscape, and portfolio strategy: * Work closely with R&D to formulate company's portfolio strategy based on the commercial assessment, scientific data, competitive landscape, market insights, and fit with company's long-term strategy. * Oversee and be accountable for commercial assessment to support portfolio decisions and prioritization of portfolio, including but not limited to commercial forecast. * Develop initial target opportunity profile, build product differentiation hypothesis, and support product development strategy decisions. * Monitor external landscape, with a focus on close competitors, and keep track of the development of competitive assets and identify potential competitive threat. * Team Leadership and Coaching: * Lead and mentor a high-performing business development and commercial assessment team. * Foster a collaborative and results-driven culture. * Provide guidance on deal structuring, relationship building, and strategic decision-making. * External Communications: * Create compelling partner pitch decks that showcase SystImmune's story and product portfolio. Collaborate closely with the scientific team to define and deliver key data packages for effective business development outreach. * Build and maintain a network of business development professionals across the pharmaceutical and biopharma industries. * Attend conferences, industry events, and investor meetings. * Organizational System Development: * Establish an internal BD organizational system: * Track and document all collaborations along the BD pipeline. * Provide regular status reports to senior leadership. Qualifications Education: Advanced degree in life sciences required, with Ph.D. or M.D. preferred Experience: * Minimum of 10 years in business development within the biopharmaceutical industry, search & evaluation experience preferred. * Deep scientific understanding of a range of modalities of cancer therapeutics required. * Proven track record of successful deal-making, including licensing, partnerships, and collaborations. * Experience managing and coaching teams. Core Skills: * Strategic thinker with a deep understanding of drug development and commercialization. * Excellent negotiation, communication, and presentation skills. * Ability to balance scientific rigor with business acumen. Interpersonal competency: * Having a mindset of adaptability, curiosity, collaboration, resilience, and a passion for purpose is critical. * Strong communication skills with effective problem-solving abilities. Compensation and Benefits: The expected base salary range for this position is $280,000 - $380,000 annually. Actual compensation will be based on a variety of factors, including but not limited to a candidate's qualifications, experience, and skills. While most offers typically fall within the low to mid-point of the range, we may extend an offer toward the higher end for exceptional candidates whose background and expertise exceeds the requirements of the role. SystImmune is a leading and well-funded biotech company with a bright future. We offer an opportunity for you to learn and grow while making significant contributions to the company's success. SystImmune offers a comprehensive benefits package including: 100% paid employee premiums for medical/dental/vision, also STD, LTD, a 401(k) plan with a 50% company match of up to 3% and a vesting schedule of only 5 years, 15 PTO days per year, sick leave, plus 11 paid holidays and MORE. We offer an opportunity for you to learn and grow while making significant contributions to the company's success. SystImmune is an Equal Opportunity Employer. We welcome diverse talent and encourage all qualified applicants to apply.
    $280k-380k yearly 48d ago
  • Vice President and Head of Business Development

    Systimmune

    Business advisor job in Princeton, NJ

    SystImmune is a leading and well-funded clinical-stage biopharmaceutical company located in Redmond, WA and Princeton, NJ. It specializes in developing innovative cancer treatments using its established drug development platforms, focusing on bi-specific, multi-specific antibodies, and antibody-drug conjugates (ADCs). SystImmune has multiple assets in various stages of clinical trials for solid tumor and hematologic indications. Alongside ongoing clinical trials. SystImmune has a robust preclinical pipeline of potential cancer therapeutics in the discover and IND-enabling stages, representing cutting-edge biologics development. We offer an opportunity for you to learn and grow while making significant contributions to the company's success. As the Vice President and Head of Business Development, you will be a key driver in shaping SystImmune's growth trajectory. Your strategic vision, leadership, and ability to develop our portfolio strategy and forge impactful partnerships will directly impact our clinical asset progress. This role combines business acumen, scientific understanding, and team management to unlock the full potential of our technology platforms and pipeline. You will report directly to the CEO and partner closely with R&D, Finance, and Manufacturing both at SystImmune and its affiliate in China. Key Responsibilities Business Development Strategy Develop and execute a comprehensive business development strategy aligned with SystImmune's scientific, strategic, and financing plans. Identify licensing, partnership, and collaboration opportunities to accelerate clinical asset development. Collaborate closely with the scientific team to define and deliver key data packages and lead all scientific due diligence process by potential partners. Develop proposed deal architecture and terms, and lead negotiations of term sheets and agreements with potential partners in collaboration with legal and finance. Commercial assessment, competitive landscape, and portfolio strategy: Work closely with R&D to formulate company's portfolio strategy based on the commercial assessment, scientific data, competitive landscape, market insights, and fit with company's long-term strategy. Oversee and be accountable for commercial assessment to support portfolio decisions and prioritization of portfolio, including but not limited to commercial forecast. Develop initial target opportunity profile, build product differentiation hypothesis, and support product development strategy decisions. Monitor external landscape, with a focus on close competitors, and keep track of the development of competitive assets and identify potential competitive threat. Team Leadership and Coaching: Lead and mentor a high-performing business development and commercial assessment team. Foster a collaborative and results-driven culture. Provide guidance on deal structuring, relationship building, and strategic decision-making. External Communications: Create compelling partner pitch decks that showcase SystImmune's story and product portfolio. Collaborate closely with the scientific team to define and deliver key data packages for effective business development outreach. Build and maintain a network of business development professionals across the pharmaceutical and biopharma industries. Attend conferences, industry events, and investor meetings. Organizational System Development: Establish an internal BD organizational system: Track and document all collaborations along the BD pipeline. Provide regular status reports to senior leadership. QualificationsEducation: Advanced degree in life sciences required, with Ph.D. or M.D. preferred Experience: Minimum of 10 years in business development within the biopharmaceutical industry, search & evaluation experience preferred. Deep scientific understanding of a range of modalities of cancer therapeutics required. Proven track record of successful deal-making, including licensing, partnerships, and collaborations. Experience managing and coaching teams. Core Skills: Strategic thinker with a deep understanding of drug development and commercialization. Excellent negotiation, communication, and presentation skills. Ability to balance scientific rigor with business acumen. Interpersonal competency: Having a mindset of adaptability, curiosity, collaboration, resilience, and a passion for purpose is critical. Strong communication skills with effective problem-solving abilities. Compensation and Benefits: The expected base salary range for this position is $280,000 - $380,000 annually. Actual compensation will be based on a variety of factors, including but not limited to a candidate's qualifications, experience, and skills. While most offers typically fall within the low to mid-point of the range, we may extend an offer toward the higher end for exceptional candidates whose background and expertise exceeds the requirements of the role. SystImmune is a leading and well-funded biotech company with a bright future. We offer an opportunity for you to learn and grow while making significant contributions to the company's success. SystImmune offers a comprehensive benefits package including: 100% paid employee premiums for medical/dental/vision, also STD, LTD, a 401(k) plan with a 50% company match of up to 3% and a vesting schedule of only 5 years, 15 PTO days per year, sick leave, plus 11 paid holidays and MORE. We offer an opportunity for you to learn and grow while making significant contributions to the company's success. SystImmune is an Equal Opportunity Employer. We welcome diverse talent and encourage all qualified applicants to apply.
    $280k-380k yearly Auto-Apply 46d ago
  • Business Integrity Associate

    Meta 4.8company rating

    Business advisor job in Trenton, NJ

    Meta Platforms, Inc. (Meta), formerly known as Facebook Inc., builds technologies that help people connect, find communities, and grow businesses. When Facebook launched in 2004, it changed the way people connect. Apps and services like Messenger, Instagram, and WhatsApp further empowered billions around the world. Now, Meta is moving beyond 2D screens toward immersive experiences like augmented and virtual reality to help build the next evolution in social technology. To apply, click "Apply to Job" online on this web page. **Required Skills:** Business Integrity Associate Responsibilities: 1. Develop compelling analyses to execute data-informed initiatives that help improve our support channels, improve the quality of our ad products and drive great service. 2. Apply expertise in quantitative analysis, data mining, and data visualization to see beyond the numbers and pull insights to help identify trends and opportunities to drive growth of our product and business. 3. Be a thought leader for data-informed initiatives and guide the team's direction overall. 4. Conduct in-depth investigations leveraging large and complex data sets. 5. Partner with Data Science, Product and Engineering teams to solve problems at scale. 6. Inform, influence, and execute new strategies and tactics using analysis and impact metrics to support your positions. 7. Telecommuting is permitted from anywhere in the U.S. **Minimum Qualifications:** Minimum Qualifications: 8. Bachelor's degree (or foreign degree equivalent) in Business Administration, Analytics, Operations Research, Statistics or a related field and 1 year of work experience in the job offered or related occupation 9. Experience must include 1 year in the following: 10. 1. Product, program and project management in the Trust & Safety space of tech product/service 11. 2. Agile methodologies, technical understanding (system architecture) and experience developing relationships with product, software engineering, operations, analysts, legal and business product marketing teams 12. 3. Meta advertising policy and human review protocol development focusing on actor-level contents and behaviors with deep knowledge in assets interaction models, operational maturity, limitations, efficiencies and tradeoffs 13. 4. Operational process development with end-to-end enforcement- appeals infrastructure process, policy/process development, escalations and investigations of advertising assets to determine if they're policy violating, or if enforcement actions were taken accurately, and 14. 5. Gathering and analyzing data/information to address complex problems using pivot tables, macros and SQL **Public Compensation:** $164,640/year to $194,480/year + bonus + equity + benefits **Industry:** Internet **Equal Opportunity:** Meta is proud to be an Equal Employment Opportunity and Affirmative Action employer. We do not discriminate based upon race, religion, color, national origin, sex (including pregnancy, childbirth, or related medical conditions), sexual orientation, gender, gender identity, gender expression, transgender status, sexual stereotypes, age, status as a protected veteran, status as an individual with a disability, or other applicable legally protected characteristics. We also consider qualified applicants with criminal histories, consistent with applicable federal, state and local law. Meta participates in the E-Verify program in certain locations, as required by law. Please note that Meta may leverage artificial intelligence and machine learning technologies in connection with applications for employment. Meta is committed to providing reasonable accommodations for candidates with disabilities in our recruiting process. If you need any assistance or accommodations due to a disability, please let us know at accommodations-ext@fb.com.
    $164.6k-194.5k yearly 60d+ ago
  • VP of Business Development

    ZP Group 4.0company rating

    Business advisor job in East Windsor, NJ

    Piper Companies is seeking VP of Business Development to lead strategic growth initiatives for a rapidly expanding line of health products. This is a HYBRID opportunity in East Windsor, New Jersey. Responsibilities of the VP of Business Development: * Drive business development strategy to grow OTC product lines across multiple commercial channels. * Build and manage partnerships with retailers, healthcare providers, and consumer health brands. * Oversee product planning and ensure alignment with regulatory standards and manufacturing capabilities. * Provide market insights and leadership to support long-term growth. Qualifications for the VP of Business Development: * Proven experience in OTC pharmaceuticals, understanding of FDA monograph regulations * Strong client-facing background with a track record of strategic partnership development * 10+ years of experience, Bachelors degree Compensation for the VP of Business Development: * Salary range: $200,000-$230,000 * Benefits: Medical, Dental, Vision, PTO, Holidays, 401K, long-term incentive * Hybrid (4 days ONSITE) This job opens for applications on 11/30/2025.. Applications will be accepted for at least 30 days from the posting date. Keywords: VP of Business Development, Business Development, OTC, over-the-counter, liquid health products, generics, generic pharmaceuticals, client-facing, strategic partnerships, product commercialization, healthcare partnerships, retail partnerships, e-commerce, contract manufacturing, portfolio strategy, FDA monograph, regulatory compliance, consumer health, pharmaceutical sales, cross-functional collaboration, market expansion, provider networks, private label, branded products, B2B partnerships, digital health, commercialization strategy #LI-KG2 #LI-HYBRID
    $200k-230k yearly 13d ago
  • VP of Business Development, HR Tech Staffing

    Meederby

    Business advisor job in Iselin, NJ

    The Vice President of Business Development will be responsible for developing and executing the sales strategy for our client's service offerings, driving revenue growth, and building strong relationships with clients. This role requires a proven leader with deep expertise in HR technology sales, payroll/staffing services and with a proven ability to get C-level meetings. This senior sales professional should have deep contacts in the financial services/insurance industries. Responsibilities: Create and implement a comprehensive sales strategy for all software & services, aligning with company objectives and market opportunities. Uncover and develop new opportunities that leverage the client's core capabilities. Originate strong relationships with Fortune 1000 prospects, key clients and partners, selling directly and through channel partnerships Conduct market research and speak to potential customers to identify trends, competitive landscape, and potential customer segments for all service solutions. Oversee the sales pipeline, ensuring accurate forecasting, tracking of key performance metrics, and timely follow-ups with prospects. Work closely with the marketing team to develop targeted campaigns and materials that effectively promote all service solutions. Regularly report on sales performance, market insights, and growth opportunities to the executive team. Qualifications: Bachelor's degree 10+ years of sales experience in HR technology or related fields, including payroll and general staffing services etc. Proven track record of driving revenue growth and achieving sales targets in a competitive environment. Strong understanding of HR Tech solutions, EOR/staffing and workforce management software & solutions. Excellent leadership, communication, and interpersonal skills. Demonstrated ability to build new lead funnels Strategic thinker with strong analytical skills and a data-driven approach to decision-making. Ability to thrive in a fast-paced, dynamic environment and adapt to changing market conditions Job Number 7556 #LI-JA1
    $135k-224k yearly est. 42d ago
  • Vice President, Business Development - Navista

    Cardinal Health 4.4company rating

    Business advisor job in Trenton, NJ

    At Navista, our mission is to empower community oncology practices to deliver patient-centered cancer care. Navista, a Cardinal Health company, is an oncology practice alliance co-created with oncologists and practice leaders that offers advanced support services and technology to help practices remain independent and thrive. True to our name, our experienced team is passionate about helping oncology practices navigate the future. This is an executive leader responsible for leading the strategic growth and development initiatives for Navista. Key responsibilities include expanding the network's reach, fostering partnerships, expanding service line offerings, and driving overall strategy to support the organization's ability to deliver exceptional patient care. The VP of Business Development will be a seasoned leader and advisor, with proven experience partnering with clinicians in oncology and across multiple therapeutic areas. They will be responsible for setting sales targets and marketing goals. Their job duties include developing production and sales goals, driving the overall monetary health of the organization, obtaining new contracts, and overseeing a sales executive and a sales operations team. This role reports to the SVP, Business Development for Navista. **Responsibilities** + Oversee the commercial operations & strategy division, to develop and execute comprehensive strategic development plans aligned with the networks mission and growth objectives + Identify opportunities for expansion, partnerships and programmatic enhancements to advance the networks presence and impact + Identify and foster relationships with healthcare providers, research institutions and other key stakeholders + Define strategic pipeline including opportunities for growth and new revenue streams, such as service line expansion, entering new markets or developing innovative programs + Collaborates with marketing and communications on the development and implementation of branding and marketing strategies to enhance the networks visibility & reputation through development of compelling messaging, promotional materials, and public relations initiatives. + Partners with Corporate Development on identifying and evaluating potential new practices and partnership + Develops and maintains strong relationships with key stakeholders, including internal sales team to drive the overall oncology strategy + Responsible for sales operations and leading and developing a team + Negotiates contracts and agreements + Proven track record of leading Teams responsible for growth through acquisitions, partnerships, and service line expansion. + Strong understanding of practice management, operations, and healthcare regulations **Qualifications** + Bachelor's degree in business administration, healthcare administration, life sciences, or a related field preferred; advanced degree (MBA, Master's in healthcare administration) preferred + 15+ in an executive strategy & development position, or similar title preferred + Demonstrated abilities for success in strategic development, business development, preferably in the healthcare industry, including identifying and evaluating market opportunities, and developing business plans for expansion & growth + Excellent communication and presentation skills, with the ability to effectively convey the network's mission and impact with physicians, staff and internal stakeholders + Familiarity with the field of Oncology including trends, healthcare regulations, treatment modalities, and research advancements + Strong business acumen and financial background, to ensure efficient allocation of resources and maximize returns on investments + Experience with leading and managing diverse teams, including hiring, training and evaluating performance + Strong analytical and problem-solving abilities + Ability to travel up to 50% **Anticipated salary range** : $166,300 - 263,235 **Bonus eligible** : Yes **Benefits** : Cardinal Health offers a wide variety of benefits and programs to support health and well-being. + Medical, dental and vision coverage + Paid time off plan + Health savings account (HSA) + 401k savings plan + Access to wages before pay day with my FlexPay + Flexible spending accounts (FSAs) + Short- and long-term disability coverage + Work-Life resources + Paid parental leave + Healthy lifestyle programs **Application window anticipated to close** : 10/30/2025 *if interested in opportunity, please submit application as soon as possible. The salary range listed is an estimate. Pay at Cardinal Health is determined by multiple factors including, but not limited to, a candidate's geographical location, relevant education, experience and skills and an evaluation of internal pay equity. _Candidates who are back-to-work, people with disabilities, without a college degree, and Veterans are encouraged to apply._ _Cardinal Health supports an inclusive workplace that values diversity of thought, experience and background. We celebrate the power of our differences to create better solutions for our customers by ensuring employees can be their authentic selves each day. Cardinal Health is an Equal_ _Opportunity/Affirmative_ _Action employer. All qualified applicants will receive consideration for employment without regard to race, religion, color, national origin, ancestry, age, physical or mental disability, sex, sexual orientation, gender identity/expression, pregnancy, veteran status, marital status, creed, status with regard to public assistance, genetic status or any other status protected by federal, state or local law._ _To read and review this privacy notice click_ here (***************************************************************************************************************************
    $166.3k-263.2k yearly 60d+ ago
  • SAP FI Treasury Business Process Consultant

    360 It Professionals 3.6company rating

    Business advisor job in Middletown, PA

    360 IT Professionals is a Software Development Company based in Fremont, California that offers complete technology services in Mobile development, Web development, Cloud computing and IT staffing. Merging Information Technology skills in all its services and operations, the company caters to its globally positioned clients by providing dynamic feasible IT solutions. 360 IT Professionals work along with its clients to deliver high-performance results, based exclusively on the one of a kind requirement. Our services are vast and we produce software and web products. We specialize in Mobile development, i.e. iPhone and Android apps. We use Objective C and Swift programming languages to create native applications for iPhone, whereas we use Android Code to develop native applications for Android devices. To create applications that work on cross-platforms, we use a number of frameworks such as Titanium, PhoneGap and JQuery mobile. Furthermore, we build web products and offer services such as web designing, layouts, responsive designing, graphic designing, web application development using frameworks based on model view controller architecture and content management system. Our services also extend to the domain of Cloud Computing, where we provide Salesforce CRM to effectively manage one's business and ease out all the operations by giving an easy platform. Apart from this, we also provide IT Staffing services that can help your organization to a great extent as you can hire highly skilled personnel's through us. We make sure that we deliver performance driven products that are optimally developed as per your organization's needs. Take a shot at us for your IT requirements and experience a radical change. Job Description MUST HAVE: • 5+ years of expertise in the following SAP Modules: o Finance (FI) o Treasury (Investment Management, Cash Management, Debt Management) o Controlling (CO) • At least 1 recent project working in the public sector • Expertise in as many of the following SAP modules as possible: o Funds Management (FM) o Financial Accounting (FA) o General Ledger (GL) o Accounts Payable (AP) o Accounts Receivable (AR) o Fixed Assets (FA) o Budgeting & Forecasting o Banking o Projects Systems (PS) o Plant Maintenance (PM) o Materials Management (MM) o Supplier Relationship Management (SRM) o Human Capital Management including Payroll (HCM) • Experience performing the following functions/tasks with SAP Treasury modules: o Configuration & maintenance o Identifying and correcting configuration issues o Providing support & training to end users o Supporting integration of Treasury & FICO modules with other SAP modules o Creating & maintaining documentation o Additional Information Thanks and Regards, Harry Singh 510 254 3300 EXT:-190 harry.singh(@360itpro.com
    $103k-132k yearly est. 22h ago
  • Business Insights Specialist (US)

    TDI 4.1company rating

    Business advisor job in Mount Laurel, NJ

    Hours: 40 Pay Details: $95,264 - $155,376 USD TD is committed to providing fair and equitable compensation opportunities to all colleagues. Growth opportunities and skill development are defining features of the colleague experience at TD. Our compensation policies and practices have been designed to allow colleagues to progress through the salary range over time as they progress in their role. The base pay actually offered may vary based upon the candidate's skills and experience, job-related knowledge, geographic location, and other specific business and organizational needs. As a candidate, you are encouraged to ask compensation related questions and have an open dialogue with your recruiter who can provide you more specific details for this role. Line of Business: Analytics, Insights, & Artificial Intelligence Job Description: Job Summary: The Business Insights Specialist is responsible for conducting analyses on curated and/or aggregated DataMart's in conjunction with deep business subject matter expertise, to generate relevant analytical insights for business issues and identify opportunities to drive business growth and value. This role works in partnership with business leaders to present or generate appropriate insights including the delivery of supporting collateral and/or presentations. Depth & Scope: Works autonomously and accountable for acting as a lead within a specialized business management function and may provide work direction to others Provides seasoned specialized knowledge, advice and/or guidance to various stakeholders and team members Scope of role may have enterprise impact Focuses on short to medium - term issues (e.g. 6-12 months) Undertakes and completes a variety of complex projects and initiatives requiring specialist knowledge and/or the integration of cross functional processes within own area of expertise Oversees and/or independently performs tasks from end-to-end May interact with any hierarchy level up to executive leaders and external vendors Education & Experience: Undergraduate degree or advanced technical degree preferred (e.g., math, physics, engineering, finance or computer science) Graduate's degree preferred with either progressive project work experience, or; 5+ year of relevant experience; higher degree education and research tenure can be counted Customer Accountabilities: Leads on the interpretation of complex business issues, generates multifaceted insights and identifies opportunities to help drive business growth or address business/enterprise needs Presents and communicates generated insights and recommended business actions to stakeholders/business leaders in an easily digestible manner, leveraging tools/techniques/methods to produce a variety of visualizations/presentations that fit the audience Acts as the primary interface with business to bridge and translate business requirements to analytics and reporting needs for a given domain/business Applies collaborative and strong stakeholder management approach to constructively influence and persuade stakeholders and partners where appropriate Serves as an authority on a given business domain and provides business expertise to place context around analytics discovery and inform recommendations Escalates data/process related problems and communicates to relevant teams in a timely manner and makes recommendations for resolution Provides day-to-day support and delivery of analytics Shareholder Accountabilities: Represents functional area as a business insights & analytics specialized expert Synthesizes complex and vast amount of information and translates into actionable insights and strategy Builds business requirements and facilitates project execution to develop insights Collaborates with partners on business challenges and delivers fact-based analytical advice that aligns to strategy and drives shareholder value Identifies opportunities for business growth within a specific business or function by identifying potential use cases and value drivers Utilizes both quantitative and qualitative methodologies to interpret and present data effectively and clearly Works directly with the business teams to gather the demand for analytics and work with the analytics hub to fulfill the analytics demand Provides business explanation for anomalies/outliers identified during analysis Works with business functions and analytics teams to transition business requirements to analytics requirements Trains business users on how to integrate analytics into decisions Leverages knowledge of data capabilities to build and deliver insights Develops analysis to corroborate initial proof of concept Executes on data requests accurately and within a timely manner Identifies and investigates data/analytics related issues Ensures business operations are in compliance with applicable internal and external requirements (e.g. financial controls, segregation of duties, transaction approvals and physical control of assets) Leads/facilitates and/or implements action/remediation plans to address performance/risk/governance issues Actively manages relationships within and across various business lines, corporate and/or control functions and ensures alignment with enterprise and/or regulatory requirements Keeps abreast of emerging issues, trends, and evolving regulatory requirements and assesses potential impacts Maintains a culture of risk management and control, supported by effective processes in alignment with risk appetite Employee/Team Accountabilities: Participates fully as a member of the team, supports a positive work environment that promotes service to the business, quality, innovation and teamwork and ensures timely communication of issues/points of interest Provides thought leadership and/or industry knowledge for own area of expertise in own area and participates in knowledge transfer within the team and business unit Keeps current on emerging trends/developments and grows knowledge of the business, related tools and techniques Participates in personal performance management and development activities, including cross training within own team Keeps others informed and up to date about the status/progress of projects and/or all relevant or useful information related to day-to-day activities Contributes to team development of skills and capabilities through mentorship of others, by sharing knowledge and experiences and leveraging best practices Leads, motivates and develops relationships with internal and external business partners/stakeholders to develop productive working relationships Contributes to a fair, positive and equitable environment that supports a diverse workforce Acts as a brand ambassador for your business area/function and the bank, both internally and/or externally Physical Requirements: Never: 0%; Occasional: 1-33%; Frequent: 34-66%; Continuous: 67-100% Domestic Travel - Occasional International Travel - Never Performing sedentary work - Continuous Performing multiple tasks - Continuous Operating standard office equipment - Continuous Responding quickly to sounds - Occasional Sitting - Continuous Standing - Occasional Walking - Occasional Moving safely in confined spaces - Occasional Lifting/Carrying (under 25 lbs.) - Occasional Lifting/Carrying (over 25 lbs.) - Never Squatting - Occasional Bending - Occasional Kneeling - Never Crawling - Never Climbing - Never Reaching overhead - Never Reaching forward - Occasional Pushing - Never Pulling - Never Twisting - Never Concentrating for long periods of time - Continuous Applying common sense to deal with problems involving standardized situations - Continuous Reading, writing and comprehending instructions - Continuous Adding, subtracting, multiplying and dividing - Continuous The above statements are intended to describe the general nature and level of work being performed by people assigned to this job. They are not intended to be an exhaustive list of all responsibilities, duties and skills required. The listed or specified responsibilities & duties are considered essential functions for ADA purposes. Who We Are: TD is one of the world's leading global financial institutions and is the fifth largest bank in North America by branches/stores. Every day, we deliver legendary customer experiences to over 27 million households and businesses in Canada, the United States and around the world. More than 95,000 TD colleagues bring their skills, talent, and creativity to the Bank, those we serve, and the economies we support. We are guided by our vision to Be the Better Bank and our purpose to enrich the lives of our customers, communities and colleagues. TD is deeply committed to being a leader in customer experience, that is why we believe that all colleagues, no matter where they work, are customer facing. As we build our business and deliver on our strategy, we are innovating to enhance the customer experience and build capabilities to shape the future of banking. Whether you've got years of banking experience or are just starting your career in financial services, we can help you realize your potential. Through regular leadership and development conversations to mentorship and training programs, we're here to support you towards your goals. As an organization, we keep growing - and so will you. Our Total Rewards Package Our Total Rewards package reflects the investments we make in our colleagues to help them and their families achieve their financial, physical and mental well-being goals. Total Rewards at TD includes base salary and variable compensation/incentive awards (e.g., eligibility for cash and/or equity incentive awards, generally through participation in an incentive plan) and several other key plans such as health and well-being benefits, savings and retirement programs, paid time off (including Vacation PTO, Flex PTO, and Holiday PTO), banking benefits and discounts, career development, and reward and recognition. Learn more Additional Information: We're delighted that you're considering building a career with TD. Through regular development conversations, training programs, and a competitive benefits plan, we're committed to providing the support our colleagues need to thrive both at work and at home. Colleague Development If you're interested in a specific career path or are looking to build certain skills, we want to help you succeed. You'll have regular career, development, and performance conversations with your manager, as well as access to an online learning platform and a variety of mentoring programs to help you unlock future opportunities. Whether you have a passion for helping customers and want to expand your experience, or you want to coach and inspire your colleagues, there are many different career paths within our organization at TD - and we're committed to helping you identify opportunities that support your goals. Training & Onboarding We will provide training and onboarding sessions to ensure that you've got everything you need to succeed in your new role. Interview Process We'll reach out to candidates of interest to schedule an interview. We do our best to communicate outcomes to all applicants by email or phone call. Accommodation TD Bank is an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, age, disability, status as a protected veteran or any other characteristic protected under applicable federal, state, or local law. If you are an applicant with a disability and need accommodations to complete the application process, please email TD Bank US Workplace Accommodations Program at ***************. Include your full name, best way to reach you and the accommodation needed to assist you with the applicant process.
    $95.3k-155.4k yearly Auto-Apply 7d ago
  • Infor Presales Business Consultant

    Tata Consulting Services 4.3company rating

    Business advisor job in Edison, NJ

    About the Job * Expert in Infor ERP application * Experience of handling the complete sales cycle & driving closure * Driving the complete RFP cycle * Experience to assess and identify customer objectives and build upon these with winning customer centric solutions and sales themes * Experience of designing the overall solution theme for the RFP response * Respond to RFPs and technical queries during the sales process * Writing RFP responses & preparing effort estimations * Working with the Client Partners & customers to identify white spaces within the customer landscape & provide solutions from Infor bouquet * Excellent Documentation & Presentation Skills * Deliver compelling product demos and presentations to executives and end-users * Attending meetings, delivering capability & proposal presentations * Experience of dealing with CXO level * In-depth knowledge of ERP implementation (preferably Infor ERP like LN or M3) * Own the revenue target Qualifications: * Engineering * MBA * 13-15 years of experience * 50%-60% travel Salary range: $131,419 - $181,591 a year #LI-MG2
    $131.4k-181.6k yearly 5d ago
  • SAP FI Treasury Business Process Consultant

    Cygnus Professionals 3.2company rating

    Business advisor job in Middletown, PA

    Headquartered in New Jersey (U.S), Cygnus Professionals Inc. is a next generation global information technology Solution and Consulting company powered by strong management and leadership team with over 30 person years of experience. Today, Cygnus has strong footprints in more than 4 countries with more than 25 satisfied customers. We strive to extend our presence across industries and geographies with our industry-focused business excellence. Cygnus Professionals Inc. has been named by the US Pan Asian American Chamber of Commerce Education Foundation (USPAACC) as one of the “Fast 100 Asian American Businesses” - joining the country's fastest-growing Asian American-owned companies, based on percentage revenue growth over the immediate past two years. Job Description SAP FI Treasury Business Process Consultant Middletown, PA 6-12 Months Contract Phone + Skype Qualifications 10+ years of expertise in the following SAP Modules: Finance (FI) Treasury (Investment Management, Cash Management, Debt Management) Recent project(s) must have involved working with Treasury module Controlling (CO) At least 1 recent project working in the public sector Expertise in as many of the following SAP modules as possible: Funds Management (FM) Financial Accounting (FA) General Ledger (GL) Accounts Payable (AP) Accounts Receivable (AR) Fixed Assets (FA) Budgeting & Forecasting Banking Projects Systems (PS) Plant Maintenance (PM) Materials Management (MM) Supplier Relationship Management (SRM) Human Capital Management including Payroll (HCM) Experience performing the following functions/tasks with SAP Treasury modules: Configuration & maintenance Identifying and correcting configuration issues Providing support & training to end users Supporting integration of Treasury & FICO modules with other SAP modules Additional Information Agile Systems/RWD uPerform ServiceNow Quality Center Panaya Standard SaaS - SAP Support Pack Automation & Test Management w/HP Quality Center Integration
    $78k-119k yearly est. 60d+ ago
  • Clinical Research Strategic Management Consultant

    Vitalief

    Business advisor job in New Brunswick, NJ

    Vitalief partners with Sites, Sponsors, and CROs to streamline research operations, reduce costs, and accelerate breakthroughs that improve patient care. We bring deep clinical research expertise together with practical, results-driven consulting to help organizations operate more efficiently and achieve sustainable growth. The Role We are seeking a highly experienced Clinical Research Strategic Management Consultant to lead a short-term engagement for a multi-location community hospital system. This role will serve as the primary subject matter expert (SME) for a comprehensive current-state operational assessment across Technology, Organization, Process, People, and Finances, with a strong focus on Non-Oncology programs and cross-system communication effectiveness. You will collaborate closely with the Vitalief delivery team to conduct structured stakeholder interviews, analyze findings, and deliver actionable recommendations and a transformation roadmap to hospital leadership. Engagement Details Part-Time: up to 20 hours/week Contract Duration: 2 months (possible extension) Pay Rate: Market competitive (depends on experience level) Location: Remote (EST zone work hours) with 1 early-stage on-site visit (expenses covered). Travel location is Northeastern USA. If you're a strategic thinker who thrives on solving complex operational challenges in clinical research, we'd love to hear from you. Responsibilities Serve as the lead Clinical Research SME for the engagement, guiding all aspects of the operational assessment. Conduct in-depth interviews with clinical research staff and stakeholders across the trial lifecycle to identify gaps, bottlenecks, and improvement opportunities for Non-Oncology operations. Collaborate with the Vitalief team to design effective interview templates and assessment tools. Compare Oncology and Non-Oncology operations to surface transferable best practices. Develop prioritized, actionable recommendations to address immediate operational deficiencies while protecting long-term integration potential. Outline a clear transformation roadmap to achieve operational excellence and improved coordination across the system. Provide regular project status updates to executive stakeholders, ensuring alignment and on-time delivery of all engagement milestones. Deliver a final executive-level presentation summarizing findings, recommendations, and measurable next steps. Qualifications: 15+ years progressive clinical research operations experience, ideally within community hospital settings. Bachelor's degree in life sciences, healthcare, or related discipline (or equivalent combination of education and experience). Proven experience in operational assessments, process improvement, and organizational transformation. Prior consulting experience delivering value-added services to external clients. Strong executive presence, negotiation skills, and the ability to present complex findings with clarity and confidence. Demonstrated ability to influence stakeholders to adopt innovative, “outside-the-box” solutions. Expertise in research operations technologies (CTMS, EMR integration, analytics tools). Strong analytical skills with the ability to quantify financial/operational benefits, assess risk, and design mitigation strategies. Demonstrated success in building C-suite relationships and leading large-scale change initiatives in complex, multi-stakeholder environments. Strategic thinker who thrives in fast-paced, entrepreneurial environments. Highly driven, results-oriented, and competitive with a collaborative leadership style. Skilled at building high-performing, cross-functional teams. Preferred Skills: Oncology and Non-Oncology operations experience. Experience managing consulting delivery teams, including role definition, coaching/mentoring, and performance management. Strong general management and P&L oversight experience. PHYSICAL DEMANDS: Prolonged periods of sitting at a desk and working at a computer. Standing, walking, visual perception, talking and hearing. Lifting up to 20lbs. Limited travel to various physical locations domestically in Northeastern USA.
    $101k-140k yearly est. Auto-Apply 10d ago
  • Corporate & Business Transactions - Life Sciences - Midlevel Associate

    Direct Counsel

    Business advisor job in Princeton, NJ

    Job Description Direct Counsel is partnering with a globally recognized law firm to identify mid-level and senior Associates for its expanding Life Sciences Corporate & Business Transactions practice. This is a premier opportunity for attorneys passionate about supporting cutting-edge biotech, pharma, and life sciences companies as they develop, partner, manufacture, and commercialize transformative technologies. About the Role The team is seeking candidates with 3-5 years of law firm experience handling a wide range of life sciences agreements, including: Collaboration agreements License agreements Supply and manufacturing agreements Product purchase and sale agreements Operational agreements such as: CDAs/NDAs MTAs SRAs CTAs MSAs Other development and commercialization arrangements In-house candidates with 2+ years of experience at a life sciences company and a strong desire to focus on life sciences transactions are also encouraged to apply. What You'll Bring Experience negotiating and drafting complex commercial and partnering agreements Strong understanding of the business and regulatory landscape governing biopharma and life sciences companies Ability to collaborate with scientific, regulatory, and business stakeholders Excellent communication skills and a business-minded approach to problem-solving This is an outstanding role for attorneys who enjoy partnering directly with innovative life sciences clients at all stages-from early R&D to commercialization. Compensation & Benefits Salary Range: $225,000 - $435,000 Final compensation will be determined based on: Relevant experience Technical and industry expertise Business needs and market conditions Location and role responsibilities Total compensation may include: Full medical and financial benefits 401(k) participation Paid vacation, sick leave, and parental leave Additional firm wide benefits and discretionary bonuses All positions are at-will, and the firm reserves the right to adjust compensation and benefits based on performance or market factors. About Direct Counsel Direct Counsel partners with leading law firms and in-house legal departments nationwide to connect talented attorneys with outstanding opportunities. We take pride in matching professionals with roles that align with their expertise, values, and long-term career goals. Apply confidentially by sending your resume to ***********************
    $63k-102k yearly est. Easy Apply 9d ago
  • Corporate & Business Transactions - Life Sciences Associate

    Vanguard-Ip

    Business advisor job in Princeton, NJ

    AmLaw 50 Firm with Cravath level compensation. Per Vault, a top firm for Associate / Partner relations and Attorney satisfaction. Exceptional programs for Training & Development and the Integration of Lateral Attorneys. Non-Hierarchical. Firm does work at the PTAB and ITC. REQUIREMENTS Seeking associates with law firm experience with life science transactions, including drafting and negotiating collaboration agreements, license agreements, supply and other operational agreements (e.g., CDA/NDAs, MTAs, SRAs, CTAs, MSAs, etc.), and product purchase and sale agreements. Alternatively, candidates with experience as in-house counsel for a life sciences industry company and a strong desire to focus on life sciences transactions would also be considered. SUMMARY Vanguard Intellectual Partners (Vanguard-IP) specializes in the placement of IP/Patent professionals nationwide. Our sole focus on intellectual property enables us to more deeply understand our clients' technical needs, and our candidates' individual talents and career interests. Our broad network of long-term client relationships gives us a competitive edge. Our recruiters all have 10+ years of IP recruiting experience, and an exceptional record of success. We have superior knowledge of the IP job market, and offer trusted career advice for our candidates. We also have the resources and high-level contacts to get your resume noticed by the people who matter. We look forward to speaking with you, and learning more about what you are seeking in your next opportunity. CONFIDENTIALITY At Vanguard-IP, we respect the confidentiality of every candidate who contacts us. Furthermore, we will always obtain expressed authorization before submitting your resume to any of our clients. **Should you have an interest in exploring opportunities in another location, we have hundreds of openings in other markets. Please apply now and our team would be happy to review your information for this or other openings in your location of interest.
    $63k-102k yearly est. 60d+ ago
  • Sr Consultant-EH&S and Sustainability Management

    Career-Mover

    Business advisor job in Newtown, PA

    The Senior Consultant role at Premium Hub, a subdivision of SAP Adoption Service Center, involves ensuring the optimal performance, availability, and smooth operation of SAP software for customers in North America. Responsibilities include analyzing SAP solutions, conducting workshops to optimize business processes, and resolving critical issues. The role requires leading engagements with customers, providing architectural guidance, and deep root cause analysis in complex environments. The ideal candidate should have a bachelor's degree in mathematics, computer science, or engineering, along with 8-10 years of SAP product experience and technical skills in programming languages like ABAP and Java. Strong communication and analytical skills are essential, and the role involves occasional business travel. This position offers opportunities to work with various SAP products and technologies. The compensation range for this role is $102,100 - $221,700 USD. SAP values diversity and inclusion, providing a collaborative and flexible work environment.
    $102.1k-221.7k yearly 60d+ ago
  • Business Development

    Coretitle

    Business advisor job in Mount Laurel, NJ

    CORE is currently seeking a hardworking and experienced Title Insurance Sales Representative. Join one of South Jersey's fastest growing title companies and most successful title team! Whether you have a well-established client base or need help taking your business to the next level, we want to meet. Increase overall resale and refinance market share in the New Jersey and Pennsylvania market by building strong relationships with REALTORS, mortgage brokers and loan originators, banks, credit unions. Team player who acts as the liaison between the inside office staff and clients in the field. Must be confident in making cold calls, prospecting for leads, as well as maintaining current customer's needs. Strong social media presence is a plus. Develop and initiate new sales and marketing ideas. Actively pursue office presentations with office brokers and staff Knowledge of real estate business is extremely helpful. Consistently increase business and revenues Candidate must possess the following: Strong work ethic. Must provide own reliable transportation. Superior time management skills OTHER REQUIREMENTS: Attending outside functions both during the day and some evenings Excellent interpersonal communication skills (both written and verbal) Ability to effectively present information one-on-one and in group settings Maintain a professional appearance and providing a positive company image EDUCATION: Minimum High School or equivalent (required) Degree in Sales and Marketing (preferred) EXPERIENCE: 2-5 years of successful sales experience in the Real Estate industry Salary is commensurate with experience Job Type: Full-time
    $76k-120k yearly est. 60d+ ago
  • Landscape Business Development - South Jersey

    Gras Lawn

    Business advisor job in Beverly, NJ

    Job DescriptionSalary: Gras Lawn, a commercial landscape company, is seeking an experienced Landscape Business Developer for the South Jersey Market. Your main responsibility is developing business with potential new customers, building and maintaining trusted relationships with key decision-makers, understanding their challenges, and creating value solutions. Your role also involves effectively identifying opportunities, gathering valuable intelligence, creating customer-centric proposals, collaborating with team members, meeting specific activity targets, and closing deals. The Business Developer focuses on strengthening Gras Lawns market presence and driving profitable growth. This position plays a key role in meeting long-term strategic objectives by fostering important customer relationships, identifying business opportunities, negotiating and closing deals, and maintaining a comprehensive understanding of the current market landscape. Identifyandunderstandthechallengesofprospectiveclientsanddevelopsolutions. Provideaccurateforecastsforsales,deliverables,andkeyperformanceindicators(KPIs). Achievesalesgoalswhilehavingtheabilitytoworkindependently. Usesalestechniquestofindnewcustomersandbuildlong-termbusinessrelationships.Also,focusonmarketingandpricingstrategies. Conductphoneprospecting,salespresentations,virtualdemonstrations,andcontractnegotiationswithminimalsupervision. Identifycustomerneedsandapplysolution-basedsellingtechniquestodemonstratethevalueof GrasLawnsserviceseffectively. Buildandnurturerelationshipswithpotentialandcurrentclients. Planyourdailyactivitiesandaimtomeetspecificperformancebenchmarkstoclosebusinessdealssuccessfully. ConsistentlyandreliablylogactivitiesintheCRM. Workeffectivelyinafast-pacedenvironmentwhilemaintainingastrongsenseofurgency. Communicateproactivelywithallclients,prospects,andcolleagues. SkillsRequired: ExtensiveexperienceintheCommercialLandscapeIndustry Proventrackrecordofsalesgoalattainmentandpipelinemanagement 3-5yearsofexperienceinB2Bsalesatmid-to-seniorlevels. Localknowledgeandcontactsinoneormoremarketsegments Proficientwithcomputerprograms,including AspireandaCRMtool Highlycompetitive,positive,andresults-driven Exceptionalmultitasker. Excellentoralandwrittencommunicationabilities,strongpresentationskills,andprofessionalexperiencewithsocialmedia. Passionate,organized,andresourcefulindividualwithoutstandinglisteningandinterpersonalskills. Highly organized, self-motivated, and hardworking, with effective time management capabilities. Easilyadaptabletonewsituations. Salary commensurate with experience. Youwillberesponsiblefor: TheBusinessDeveloperoverseesthesalespipelinefromtheprospectingstagetoclosingandisaccountablefortheentiresalescycle,includingsnowsalesincertainregions.Additionally,the BusinessDeveloperworksincollaborationwithpartnersacrossoperations,finance,marketing,andotherdepartmentstoeffectivelyrespondtobidsandachievesalesgoals. Salary commensurate with experience.
    $76k-120k yearly est. 5d ago
  • Business Insights Specialist (US)

    TD Bank 4.5company rating

    Business advisor job in Mount Laurel, NJ

    Hours: 40 Pay Details: $95,264 - $155,376 USD TD is committed to providing fair and equitable compensation opportunities to all colleagues. Growth opportunities and skill development are defining features of the colleague experience at TD. Our compensation policies and practices have been designed to allow colleagues to progress through the salary range over time as they progress in their role. The base pay actually offered may vary based upon the candidate's skills and experience, job-related knowledge, geographic location, and other specific business and organizational needs. As a candidate, you are encouraged to ask compensation related questions and have an open dialogue with your recruiter who can provide you more specific details for this role. Line of Business: Analytics, Insights, & Artificial Intelligence Job Description: Job Summary: The Business Insights Specialist is responsible for conducting analyses on curated and/or aggregated DataMart's in conjunction with deep business subject matter expertise, to generate relevant analytical insights for business issues and identify opportunities to drive business growth and value. This role works in partnership with business leaders to present or generate appropriate insights including the delivery of supporting collateral and/or presentations. Depth & Scope: * Works autonomously and accountable for acting as a lead within a specialized business management function and may provide work direction to others * Provides seasoned specialized knowledge, advice and/or guidance to various stakeholders and team members * Scope of role may have enterprise impact * Focuses on short to medium - term issues (e.g. 6-12 months) * Undertakes and completes a variety of complex projects and initiatives requiring specialist knowledge and/or the integration of cross functional processes within own area of expertise * Oversees and/or independently performs tasks from end-to-end * May interact with any hierarchy level up to executive leaders and external vendors Education & Experience: * Undergraduate degree or advanced technical degree preferred (e.g., math, physics, engineering, finance or computer science) Graduate's degree preferred with either progressive project work experience, or; * 5+ year of relevant experience; higher degree education and research tenure can be counted Customer Accountabilities: * Leads on the interpretation of complex business issues, generates multifaceted insights and identifies opportunities to help drive business growth or address business/enterprise needs * Presents and communicates generated insights and recommended business actions to stakeholders/business leaders in an easily digestible manner, leveraging tools/techniques/methods to produce a variety of visualizations/presentations that fit the audience * Acts as the primary interface with business to bridge and translate business requirements to analytics and reporting needs for a given domain/business * Applies collaborative and strong stakeholder management approach to constructively influence and persuade stakeholders and partners where appropriate * Serves as an authority on a given business domain and provides business expertise to place context around analytics discovery and inform recommendations * Escalates data/process related problems and communicates to relevant teams in a timely manner and makes recommendations for resolution * Provides day-to-day support and delivery of analytics Shareholder Accountabilities: * Represents functional area as a business insights & analytics specialized expert * Synthesizes complex and vast amount of information and translates into actionable insights and strategy * Builds business requirements and facilitates project execution to develop insights * Collaborates with partners on business challenges and delivers fact-based analytical advice that aligns to strategy and drives shareholder value * Identifies opportunities for business growth within a specific business or function by identifying potential use cases and value drivers * Utilizes both quantitative and qualitative methodologies to interpret and present data effectively and clearly * Works directly with the business teams to gather the demand for analytics and work with the analytics hub to fulfill the analytics demand * Provides business explanation for anomalies/outliers identified during analysis * Works with business functions and analytics teams to transition business requirements to analytics requirements * Trains business users on how to integrate analytics into decisions * Leverages knowledge of data capabilities to build and deliver insights * Develops analysis to corroborate initial proof of concept * Executes on data requests accurately and within a timely manner * Identifies and investigates data/analytics related issues * Ensures business operations are in compliance with applicable internal and external requirements (e.g. financial controls, segregation of duties, transaction approvals and physical control of assets) * Leads/facilitates and/or implements action/remediation plans to address performance/risk/governance issues * Actively manages relationships within and across various business lines, corporate and/or control functions and ensures alignment with enterprise and/or regulatory requirements * Keeps abreast of emerging issues, trends, and evolving regulatory requirements and assesses potential impacts * Maintains a culture of risk management and control, supported by effective processes in alignment with risk appetite Employee/Team Accountabilities: * Participates fully as a member of the team, supports a positive work environment that promotes service to the business, quality, innovation and teamwork and ensures timely communication of issues/points of interest * Provides thought leadership and/or industry knowledge for own area of expertise in own area and participates in knowledge transfer within the team and business unit * Keeps current on emerging trends/developments and grows knowledge of the business, related tools and techniques * Participates in personal performance management and development activities, including cross training within own team * Keeps others informed and up to date about the status/progress of projects and/or all relevant or useful information related to day-to-day activities * Contributes to team development of skills and capabilities through mentorship of others, by sharing knowledge and experiences and leveraging best practices * Leads, motivates and develops relationships with internal and external business partners/stakeholders to develop productive working relationships * Contributes to a fair, positive and equitable environment that supports a diverse workforce * Acts as a brand ambassador for your business area/function and the bank, both internally and/or externally Physical Requirements: Never: 0%; Occasional: 1-33%; Frequent: 34-66%; Continuous: 67-100% * Domestic Travel - Occasional * International Travel - Never * Performing sedentary work - Continuous * Performing multiple tasks - Continuous * Operating standard office equipment - Continuous * Responding quickly to sounds - Occasional * Sitting - Continuous * Standing - Occasional * Walking - Occasional * Moving safely in confined spaces - Occasional * Lifting/Carrying (under 25 lbs.) - Occasional * Lifting/Carrying (over 25 lbs.) - Never * Squatting - Occasional * Bending - Occasional * Kneeling - Never * Crawling - Never * Climbing - Never * Reaching overhead - Never * Reaching forward - Occasional * Pushing - Never * Pulling - Never * Twisting - Never * Concentrating for long periods of time - Continuous * Applying common sense to deal with problems involving standardized situations - Continuous * Reading, writing and comprehending instructions - Continuous * Adding, subtracting, multiplying and dividing - Continuous The above statements are intended to describe the general nature and level of work being performed by people assigned to this job. They are not intended to be an exhaustive list of all responsibilities, duties and skills required. The listed or specified responsibilities & duties are considered essential functions for ADA purposes. Who We Are: TD is one of the world's leading global financial institutions and is the fifth largest bank in North America by branches/stores. Every day, we deliver legendary customer experiences to over 27 million households and businesses in Canada, the United States and around the world. More than 95,000 TD colleagues bring their skills, talent, and creativity to the Bank, those we serve, and the economies we support. We are guided by our vision to Be the Better Bank and our purpose to enrich the lives of our customers, communities and colleagues. TD is deeply committed to being a leader in customer experience, that is why we believe that all colleagues, no matter where they work, are customer facing. As we build our business and deliver on our strategy, we are innovating to enhance the customer experience and build capabilities to shape the future of banking. Whether you've got years of banking experience or are just starting your career in financial services, we can help you realize your potential. Through regular leadership and development conversations to mentorship and training programs, we're here to support you towards your goals. As an organization, we keep growing - and so will you. Our Total Rewards Package Our Total Rewards package reflects the investments we make in our colleagues to help them and their families achieve their financial, physical and mental well-being goals. Total Rewards at TD includes base salary and variable compensation/incentive awards (e.g., eligibility for cash and/or equity incentive awards, generally through participation in an incentive plan) and several other key plans such as health and well-being benefits, savings and retirement programs, paid time off (including Vacation PTO, Flex PTO, and Holiday PTO), banking benefits and discounts, career development, and reward and recognition. Learn more Additional Information: We're delighted that you're considering building a career with TD. Through regular development conversations, training programs, and a competitive benefits plan, we're committed to providing the support our colleagues need to thrive both at work and at home. Colleague Development If you're interested in a specific career path or are looking to build certain skills, we want to help you succeed. You'll have regular career, development, and performance conversations with your manager, as well as access to an online learning platform and a variety of mentoring programs to help you unlock future opportunities. Whether you have a passion for helping customers and want to expand your experience, or you want to coach and inspire your colleagues, there are many different career paths within our organization at TD - and we're committed to helping you identify opportunities that support your goals. Training & Onboarding We will provide training and onboarding sessions to ensure that you've got everything you need to succeed in your new role. Interview Process We'll reach out to candidates of interest to schedule an interview. We do our best to communicate outcomes to all applicants by email or phone call. Accommodation TD Bank is an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, age, disability, status as a protected veteran or any other characteristic protected under applicable federal, state, or local law. If you are an applicant with a disability and need accommodations to complete the application process, please email TD Bank US Workplace Accommodations Program at ***************. Include your full name, best way to reach you and the accommodation needed to assist you with the applicant process.
    $95.3k-155.4k yearly Auto-Apply 7d ago
  • Business Office Accounting Intern, part-time

    The Hun School of Princeton 4.1company rating

    Business advisor job in Princeton, NJ

    Part-time Description The Hun School of Princeton seeks a Business Office Accounting Intern to assist with daily accounting activities, correspondence, organization, and general business office tasks. The accounting intern can expect to learn and participate in financial data preparation, create, maintain and track data in various software programs, assist with the advancement of the accounting system, basic general ledger functions, billing, and other general accounting activities. This position reports to the Controller, is part time, (paid) non-exempt, and will work five (5) days per week (Monday through Friday) and five (5) hours per day; hours worked can be flexible within the School's business hours (8am to 4pm) for a total of twenty-five (25) hours per week. Responsibilities and Essential functions: Shadow members of the business office as they perform their duties; Learn the accounting basics of working as a part of the business office team to compile and analyze data, track information and support the School community; Assist with research, data entry, recording, tracking, and maintenance of accurate account documentation and financial records; Identify, research and resolve discrepancies and issues; Prepare monthly reconciliations of general ledger balances for analysis; Develop and execute correspondence for billing, collections and other accounting activities requiring a high volume of (verbal and written) contact; Maintain excel spreadsheets to provide detail reporting and follow up related to accounting system; Work to understand the mapping of reports in the system to provide needed information to all departments for actual and budget reporting; Back up front desk staff to cover vacations/sick time; Perform tasks which are supportive in nature to the essential functions of the job, which may be altered or redesigned as necessary. Requirements Recent graduate or actively working towards a degree in accounting or relevant degree; Strong understanding of accounting and financial principles; Excellent technology skills including Microsoft Office suite, advanced Excel skills, and Google Mail (Gmail) applications are required; Detail oriented as well as thorough and accurate; Must possess good judgment, tact, sensitivity, and discretion with confidential information, materials and situations; Comfortable working in a fast paced and dynamic school atmosphere; Collaboration and teamwork skills; Good social skills and the ability to interact and work within a diverse community including co-workers, staff, faculty, students, alumni and parents; Must be fingerprinted and pass the State of New Jersey criminal background check. Hourly Rate Range: $22.50 to $25 per hour Eligible employees receive a robust benefits package that includes health, dental, vision, and prescription insurance coverage, retirement plan options with a school matching program, life and disability insurance, opportunities for professional development, and a variety of other valuable programs and benefits designed to enhance employee well-being. The Hun School of Princeton is an E-Verify employer. Information regarding E-Verify can be found here: E-Verify.gov. To Apply: The Hun School of Princeton Employment Application ABOUT THE HUN SCHOOL The Hun School of Princeton is a co-educational, private day and boarding school in Princeton, New Jersey. Individual attention and strong student-faculty relationships are the hallmarks of the School. On the 50-acre campus between Philadelphia and New York City, student-centered, hands-on learning prepares students for the global community in which they will live and work. The Hun School is comprised of nearly 700 students in its Middle School, Upper School, and Postgraduate Program. Our campus is home to students from twenty-two countries and fifteen states. Our campus is located in historic Princeton, New Jersey, a short train ride away from both New York City (50 miles) and Philadelphia (45 miles). Home to Princeton University, The Institute for Advanced Study, Princeton Theological Seminary, and an array of cultural centers and organizations, Princeton is regarded as one of the most academically-minded communities in the world. Often named one of the country's best places to live, Princeton is a friendly, multicultural community surrounded by mountains, parks, and lakes. There are award-winning museums and theatres, celebrated public and private schools, destination restaurants and hotels, and a robust calendar of community events to enjoy. Our mission: The Hun School of Princeton empowers each student to thrive in a diverse and ever-changing world, by nurturing resilient character, providing individual mentorship, and inspiring vigorous and joyful learning. Our community: In our mission of educating global citizens with resilient character, we actively seek candidates who can bring a diversity of experiences and perspectives to our community. The Hun School of Princeton is an equal opportunity employer and does not discriminate in employment opportunities or practices on the basis of race, color, religion, sex, sexual orientation, national origin, age, disability, or any other characteristics or activity protected by law. The Hun School of Princeton is an E-Verify employer. Information regarding E-Verify can be found here: E-Verify.gov.
    $22.5-25 hourly 60d+ ago
  • Business Development Associate

    Venture Solar 3.9company rating

    Business advisor job in New Brunswick, NJ

    Venture Solar is hiring a Business Development Associate. A Solar Sales Consultant is not a lead generation role where you will be asked to knock on doors or cold call. We are seeking experienced sales representatives that are closers with a track record of success in sales and are looking for the right environment to be successful. Our appointment setting teams will schedule qualified appointments on your calendar for you to meet with the homeowner(s) and close with the best combination of products, services, and track record in the industry. We view the sales process in solar to be educational and we realize that it is an emotional decision for people to make the switch, so we focus on making sure that our customers understand not just how solar works, but also where the money is coming from to help pay for their project so that it doesn't seem "too good to be true". What you'll bring: Sales experience - Required Outside sales (In home sales) - preferred Solar experience - welcomed Willingness to learn Benefits: Base salary plus commission 401k match program Health, Dental, and Vision insurance Paid Time Off Compensation: Base salary + uncapped commission (OTE $100,000-$250,000) #vs1
    $68k-123k yearly est. Auto-Apply 52d ago

Learn more about business advisor jobs

How much does a business advisor earn in Lakewood, NJ?

The average business advisor in Lakewood, NJ earns between $79,000 and $175,000 annually. This compares to the national average business advisor range of $67,000 to $138,000.

Average business advisor salary in Lakewood, NJ

$118,000
Job type you want
Full Time
Part Time
Internship
Temporary