Business advisor jobs in Lakewood, NJ - 270 jobs

At Navista, our mission is to empower community oncology practices to deliver patient-centered cancer care. Navista, a Cardinal Health company, is an oncology practice alliance co-created with oncologists and practice leaders that offers advanced support services and technology to help practices remain independent and thrive. True to our name, our experienced team is passionate about helping oncology practices navigate the future. This is an executive leader responsible for leading the strategic growth and development initiatives for Navista. Key responsibilities include expanding the network's reach, fostering partnerships, expanding service line offerings, and driving overall strategy to support the organization's ability to deliver exceptional patient care. The VP of Business Development will be a seasoned leader and advisor, with proven experience partnering with clinicians in oncology and across multiple therapeutic areas. They will be responsible for setting sales targets and marketing goals. Their job duties include developing production and sales goals, driving the overall monetary health of the organization, obtaining new contracts, and overseeing a sales executive. This role reports to the SVP/GM of Navista. **Responsibilities** + Oversee the commercial operations & strategy division, to develop and execute comprehensive strategic development plans aligned with the networks mission and growth objectives + Identify opportunities for expansion, partnerships and programmatic enhancements to advance the networks presence and impact + Identify and foster relationships with healthcare providers, research institutions and other key stakeholders + Define strategic pipeline including opportunities for growth and new revenue streams, such as service line expansion, entering new markets or developing innovative programs + Collaborates with marketing and communications on the development and implementation of branding and marketing strategies to enhance the networks visibility & reputation through development of compelling messaging, promotional materials, and public relations initiatives. + Partners with Corporate Development on identifying and evaluating potential new practices and partnership + Develops and maintains strong relationships with key stakeholders, including internal sales team to drive the overall oncology strategy + Responsible for sales operations and leading and developing a team + Negotiates contracts and agreements + Proven track record of leading Teams responsible for growth through acquisitions, partnerships, and service line expansion. + Strong understanding of practice management, operations, and healthcare regulations **Qualifications** + Bachelor's degree in business administration, healthcare administration, life sciences, or a related field preferred; advanced degree (MBA, Master's in healthcare administration) preferred + 15+ in an executive strategy & development position, or similar title preferred + Demonstrated abilities for success in strategic development, business development, preferably in the healthcare industry, including identifying and evaluating market opportunities, and developing business plans for expansion & growth + Experience in a Business Development or Growth role with a Managed Services Organization (MSO) or in the specialty community practice space preferred + Excellent communication and presentation skills, with the ability to effectively convey the network's mission and impact with physicians, staff and internal stakeholders + Familiarity with Oncology, Urology, or other specialties, including trends, healthcare regulations, treatment modalities, and research advancements + Strong business acumen and financial background, to ensure efficient allocation of resources and maximize returns on investments + Experience with leading and managing diverse teams, including hiring, training and evaluating performance + Strong analytical and problem-solving abilities + Ability to travel up to 50% **Anticipated salary range** : $166,300 - 255,700 **Bonus eligible** : Yes **Benefits** : Cardinal Health offers a wide variety of benefits and programs to support health and well-being. + Medical, dental and vision coverage + Paid time off plan + Health savings account (HSA) + 401k savings plan + Access to wages before pay day with my FlexPay + Flexible spending accounts (FSAs) + Short- and long-term disability coverage + Work-Life resources + Paid parental leave + Healthy lifestyle programs **Application window anticipated to close** : 1/15/2026 *if interested in opportunity, please submit application as soon as possible. The salary range listed is an estimate. Pay at Cardinal Health is determined by multiple factors including, but not limited to, a candidate's geographical location, relevant education, experience and skills and an evaluation of internal pay equity. _Candidates who are back-to-work, people with disabilities, without a college degree, and Veterans are encouraged to apply._ _Cardinal Health supports an inclusive workplace that values diversity of thought, experience and background. We celebrate the power of our differences to create better solutions for our customers by ensuring employees can be their authentic selves each day. Cardinal Health is an Equal_ _Opportunity/Affirmative_ _Action employer. All qualified applicants will receive consideration for employment without regard to race, religion, color, national origin, ancestry, age, physical or mental disability, sex, sexual orientation, gender identity/expression, pregnancy, veteran status, marital status, creed, status with regard to public assistance, genetic status or any other status protected by federal, state or local law._ _To read and review this privacy notice click_ here (***************************************************************************************************************************

360 IT Professionals is a Software Development Company based in Fremont, California that offers complete technology services in Mobile development, Web development, Cloud computing and IT staffing. Merging Information Technology skills in all its services and operations, the company caters to its globally positioned clients by providing dynamic feasible IT solutions. 360 IT Professionals work along with its clients to deliver high-performance results, based exclusively on the one of a kind requirement. Our services are vast and we produce software and web products. We specialize in Mobile development, i.e. iPhone and Android apps. We use Objective C and Swift programming languages to create native applications for iPhone, whereas we use Android Code to develop native applications for Android devices. To create applications that work on cross-platforms, we use a number of frameworks such as Titanium, PhoneGap and JQuery mobile. Furthermore, we build web products and offer services such as web designing, layouts, responsive designing, graphic designing, web application development using frameworks based on model view controller architecture and content management system. Our services also extend to the domain of Cloud Computing, where we provide Salesforce CRM to effectively manage one's business and ease out all the operations by giving an easy platform. Apart from this, we also provide IT Staffing services that can help your organization to a great extent as you can hire highly skilled personnel's through us. We make sure that we deliver performance driven products that are optimally developed as per your organization's needs. Take a shot at us for your IT requirements and experience a radical change. Job Description MUST HAVE: • 5+ years of expertise in the following SAP Modules: o Finance (FI) o Treasury (Investment Management, Cash Management, Debt Management) o Controlling (CO) • At least 1 recent project working in the public sector • Expertise in as many of the following SAP modules as possible: o Funds Management (FM) o Financial Accounting (FA) o General Ledger (GL) o Accounts Payable (AP) o Accounts Receivable (AR) o Fixed Assets (FA) o Budgeting & Forecasting o Banking o Projects Systems (PS) o Plant Maintenance (PM) o Materials Management (MM) o Supplier Relationship Management (SRM) o Human Capital Management including Payroll (HCM) • Experience performing the following functions/tasks with SAP Treasury modules: o Configuration & maintenance o Identifying and correcting configuration issues o Providing support & training to end users o Supporting integration of Treasury & FICO modules with other SAP modules o Creating & maintaining documentation o Additional Information Thanks and Regards, Harry Singh 510 254 3300 EXT:-190 harry.singh(@360itpro.com

We are looking for a mid-level sales manager (business development manager) that can help us with client acquisition in IT services. Requirement: * Must carry past experience in selling IT/Tech services to clients * Must be able to help us by bringing in US based clients/companies to us that need big data services * 4+ years experience in IT sales * Proven sales figures from the past * Proven strong contacts with IT decision makers at large and medium size companies This position comes with a strong commission structure. Additional Information All your information will be kept confidential according to EEO guidelines.

**Business Consultant -** **Carelon Payment Integrity** **Location** : This role requires associates to be in-office **1-2** days per week, fostering collaboration and connectivity, while providing flexibility to support productivity and work-life balance. This approach combines structured office engagement with the autonomy of virtual work, promoting a dynamic and adaptable workplace. Alternate locations may be considered. _Please note that per our policy on hybrid/virtual work, candidates not within a reasonable commuting distance from the posting location(s) will not be considered for employment, unless an accommodation is granted as required by law._ **Carelon Payment Integrity** is a proud member of the Elevance Health family of companies, Carelon Insights, formerly Payment Integrity, is determined to recover, eliminate and prevent unnecessary medical-expense spending. The **Business Consultant** is a member of our **Carelon Payment Integrity's Data Mining Team** , where we utilize advanced analytics to uncover anomalies and drive real savings. This position plays a critical role in uncovering claims overpayments and guiding clients through implementation of data-driven insights. This individual will be data mining, finding anomalies and validating our findings for external clients. **How you will make an impact:** + May lead teams of analysts assigned to complex projects. + Determines specific business application software requirements to address complex and varied business needs. + Analyzes and designs solutions to address complex and varied business needs. + Consults with business partners concerning application and implementation of technology. + Lead client consultations to identify and resolve payment integrity issues. + Analyze complex claim scenarios and business rules to uncover overpayments. + Guide cross-functional teams through the development and implementation of recovery strategies. + Design business solutions to address diverse client requirements. + Partner with query developers to refine logic based on client data and operational feedback. + Facilitate internal and external meetings, ensuring alignment across stakeholders. + Document findings, track projects, and manage timelines to successful delivery. **Minimum Requirements:** Requires a BA/BS and minimum of 8 years business analysis experience, which should include analysis and project management; or any combination of education and experience which would provide an equivalent background. **Preferred Skills, Capabilities and Experiences:** + Prior experience in healthcare claims, payment integrity, or consulting highly preferred. + Strong understanding of claims processing, coding practices, reimbursement policies, and payer-provider contracting preferred. + Demonstrated ability to work directly with clients and build long-term relationships preferred. + Advanced MS Excel capabilities required (pivot tables, VLOOKUP, formulas) highly preferred. + Experience leading projects and managing cross-functional stakeholders preferred. + Coding certification (e.g., CPC) is strongly preferred. + Strong verbal and written communication skills are highly preferred. + Ability to translate technical findings into actionable business strategies preferred. + Experience with client/vendor relations, customer service, or healthcare analytics a plus. _If this job is assigned to any Government Business Division entity, the applicant and incumbent fall under a 'sensitive position' work designation and may be subject to additional requirements beyond those associates outside Government Business Divisions. Requirements include but are not limited to more stringent and frequent background checks and/or government clearances, segregation of duties principles, role specific training, monitoring of daily job functions, and sensitive data handling instructions. Associates in these jobs must follow the specific policies, procedures, guidelines, etc. as stated by the Government Business Division in which they are employed._ For candidates working in person or virtually in the below location(s), the salary* range for this specific position is $92,064 to $151,248 Locations: Maryland, Massachusetts, Minnesota, New Jersey; New York In addition to your salary, Elevance Health offers benefits such as a comprehensive benefits package, incentive and recognition programs, equity stock purchase and 401k contribution (all benefits are subject to eligibility requirements). The salary offered for this specific position is based on a number of legitimate, non-discriminatory factors set by the Company. The Company is fully committed to ensuring equal pay opportunities for equal work regardless of gender, race, or any other category protected by federal, state, and local pay equity laws. *The salary range is the range Elevance Health in good faith believes is the range of possible compensation for this role at the time of this posting. This range may be modified in the future and actual compensation may vary from posting based on geographic location, work experience, education and/or skill level. Even within the range, the actual compensation will vary depending on the above factors as well as market/business considerations. No amount is considered to be wages or compensation until such amount is earned, vested, and determinable under the terms and conditions of the applicable policies and plans. The amount and availability of any bonus, commission, benefits, paid time off, stock, or any other form of compensation and benefits that are allocable to a particular employee remains in the Company's sole discretion unless and until paid and may be modified at the Company's sole discretion, consistent with the law. Please be advised that Elevance Health only accepts resumes for compensation from agencies that have a signed agreement with Elevance Health. Any unsolicited resumes, including those submitted to hiring managers, are deemed to be the property of Elevance Health. Who We Are Elevance Health is a health company dedicated to improving lives and communities - and making healthcare simpler. We are a Fortune 25 company with a longstanding history in the healthcare industry, looking for leaders at all levels of the organization who are passionate about making an impact on our members and the communities we serve. How We Work At Elevance Health, we are creating a culture that is designed to advance our strategy but will also lead to personal and professional growth for our associates. Our values and behaviors are the root of our culture. They are how we achieve our strategy, power our business outcomes and drive our shared success - for our consumers, our associates, our communities and our business. We offer a range of market-competitive total rewards that include merit increases, paid holidays, Paid Time Off, and incentive bonus programs (unless covered by a collective bargaining agreement), medical, dental, vision, short and long term disability benefits, 401(k) +match, stock purchase plan, life insurance, wellness programs and financial education resources, to name a few. Elevance Health operates in a Hybrid Workforce Strategy. Unless specified as primarily virtual by the hiring manager, associates are required to work at an Elevance Health location at least once per week, and potentially several times per week. Specific requirements and expectations for time onsite will be discussed as part of the hiring process. The health of our associates and communities is a top priority for Elevance Health. We require all new candidates in certain patient/member-facing roles to become vaccinated against COVID-19 and Influenza. If you are not vaccinated, your offer will be rescinded unless you provide an acceptable explanation. Elevance Health will also follow all relevant federal, state and local laws. Elevance Health is an Equal Employment Opportunity employer and all qualified applicants will receive consideration for employment without regard to age, citizenship status, color, creed, disability, ethnicity, genetic information, gender (including gender identity and gender expression), marital status, national origin, race, religion, sex, sexual orientation, veteran status or any other status or condition protected by applicable federal, state, or local laws. Applicants who require accommodation to participate in the job application process may contact ******************************************** for assistance. Qualified applicants with arrest or conviction records will be considered for employment in accordance with all federal, state, and local laws, including, but not limited to, the Los Angeles County Fair Chance Ordinance and the California Fair Chance Act.

About the Job * Expert in Infor ERP application * Experience of handling the complete sales cycle & driving closure * Driving the complete RFP cycle * Experience to assess and identify customer objectives and build upon these with winning customer centric solutions and sales themes * Experience of designing the overall solution theme for the RFP response * Respond to RFPs and technical queries during the sales process * Writing RFP responses & preparing effort estimations * Working with the Client Partners & customers to identify white spaces within the customer landscape & provide solutions from Infor bouquet * Excellent Documentation & Presentation Skills * Deliver compelling product demos and presentations to executives and end-users * Attending meetings, delivering capability & proposal presentations * Experience of dealing with CXO level * In-depth knowledge of ERP implementation (preferably Infor ERP like LN or M3) * Own the revenue target Qualifications: * Engineering * MBA * 13-15 years of experience * 50%-60% travel Salary range: $131,419 - $181,591 a year #LI-MG2

Hours: 40 Pay Details: $86,840 - $139,360 USD TD is committed to providing fair and equitable compensation opportunities to all colleagues. Growth opportunities and skill development are defining features of the colleague experience at TD. Our compensation policies and practices have been designed to allow colleagues to progress through the salary range over time as they progress in their role. The base pay actually offered may vary based upon the candidate's skills and experience, job-related knowledge, geographic location, and other specific business and organizational needs. As a candidate, you are encouraged to ask compensation related questions and have an open dialogue with your recruiter who can provide you more specific details for this role. Line of Business: Business Management, Strategy & Support Job Description: The Control Remediation Quality Assurance Business Management Specialist will have appropriate Audit or Risk and Controls subject matter expertise to assist each Remediation owner through the end-to-end Remediation lifecycle. This role is an integral part of the Review & Challenge tollgate panels at both the workstream and full concern level, ensuring effective remediation, leading to successful Internal Audit validation. This role engages with stakeholders to provide ongoing support as well as receive feedback on R&C coordinator team efforts to identify opportunities to enhance the end-to-end remediation program. Depth & Scope: Works autonomously and accountable for acting as a lead within a specialized business management function and may provide work direction to others Provides seasoned specialized knowledge, advice and/or guidance to various stakeholders and team members Scopes of role may have enterprise impact Focuses on short to medium - term issues (e.g. 6-12 months) Undertakes and completes a variety of complex projects and initiatives requiring specialist knowledge and/or the integration of cross functional processes within own area of expertise Oversees and/or independently performs tasks from end to end Education & Experience: Undergraduate degree 7+ years relevant experience Preferred Qualifications: 7+ years of Audit/Risk and Controls experience is preferred Subject matter expertise within the banking industry Highly organized, with demonstrated ability to develop, analyze, improve and apply complex policies, processes and procedures Solid understanding of Regulatory environment and its role in the banking industry Effective negotiation and influencing skills Advanced communication and presentation skills Works independently as an individual contributor to provide end-to-end support for remediation; including feedback on control of environment Works with all lines of defense on remediation efforts Customer Accountabilities: Contributes to the strategic direction of the business management function and play a key role in the development and implementation of strategies in support of the overall business strategy Plans, leads / manages and/or oversees a diverse set of work activities requiring alignment across multiple areas Leads / manages the integrated implementation of policies / processes / procedures / changes in across multiple functional areas Provides direction and/or input to complex, wide ranging enterprise or cross-function / business projects/initiatives as a subject matter expert and where necessary participates in identifying, designing and testing solutions and supporting the implementation Facilitates key discussions and provides thought leadership to executive audience (output is roadmap and/or strategic plan/ deliverables/frameworks/ short to long term goals etc.) Leads partner to management / leadership and respective teams for area of specialization with industry, external and internal, enterprise and business awareness; recognizing and anticipating emerging trends and; identifying issues and opportunities and recommending action to senior management Works effectively with multiple teams across a broad spectrum of initiatives and functional domains, influencing others as needed Shareholder Accountabilities: Adheres to enterprise frameworks and methodologies that relate to business management activities for own area Actively manages relationships with corporate and/or control functions and ensure alignment with enterprise and/or regulatory requirements Keeps abreast of emerging issues, trends, and evolving regulatory requirements and assess potential impacts to the Bank Assesses / identifies key issues and escalate to appropriate levels and relevant stakeholders where required Maintains a culture of risk management and control, supported by effective processes and sound infrastructure an in alignment with risk appetite Ensures business operations are in compliance with applicable internal and external requirements (e.g. financial controls, segregation of duties, transaction approvals, and physical control of assets). Participates in cross-functional / enterprise initiatives as a subject matter expert helping to identify risk / provide guidance for complex situations Leads relevant governance meetings or committees and related deliverables / outcomes Leads / facilitates and/or implements action/remediation plans to address performance/risk/governance issues Employee/Team Accountabilities: Provides thought leadership and/or industry knowledge for own area of expertise Supports a positive work environment that promotes service to the business, quality, innovation and teamwork and ensure timely communication of issues/ points of interest Identifies and recommends opportunities to enhance productivity, effectiveness and operational efficiency Works effectively as a team, supporting other members of the team in achieving business objectives and providing client services Participates in knowledge transfer within the team and business units Who We Are: TD is one of the world's leading global financial institutions and is the fifth largest bank in North America by branches/stores. Every day, we deliver legendary customer experiences to over 27 million households and businesses in Canada, the United States and around the world. More than 95,000 TD colleagues bring their skills, talent, and creativity to the Bank, those we serve, and the economies we support. We are guided by our vision to Be the Better Bank and our purpose to enrich the lives of our customers, communities and colleagues. TD is deeply committed to being a leader in customer experience, that is why we believe that all colleagues, no matter where they work, are customer facing. As we build our business and deliver on our strategy, we are innovating to enhance the customer experience and build capabilities to shape the future of banking. Whether you've got years of banking experience or are just starting your career in financial services, we can help you realize your potential. Through regular leadership and development conversations to mentorship and training programs, we're here to support you towards your goals. As an organization, we keep growing - and so will you. Our Total Rewards Package Our Total Rewards package reflects the investments we make in our colleagues to help them and their families achieve their financial, physical and mental well-being goals. Total Rewards at TD includes base salary and variable compensation/incentive awards (e.g., eligibility for cash and/or equity incentive awards, generally through participation in an incentive plan) and several other key plans such as health and well-being benefits, savings and retirement programs, paid time off (including Vacation PTO, Flex PTO, and Holiday PTO), banking benefits and discounts, career development, and reward and recognition. Learn more Additional Information: We're delighted that you're considering building a career with TD. Through regular development conversations, training programs, and a competitive benefits plan, we're committed to providing the support our colleagues need to thrive both at work and at home. Colleague Development If you're interested in a specific career path or are looking to build certain skills, we want to help you succeed. You'll have regular career, development, and performance conversations with your manager, as well as access to an online learning platform and a variety of mentoring programs to help you unlock future opportunities. Whether you have a passion for helping customers and want to expand your experience, or you want to coach and inspire your colleagues, there are many different career paths within our organization at TD - and we're committed to helping you identify opportunities that support your goals. Training & Onboarding We will provide training and onboarding sessions to ensure that you've got everything you need to succeed in your new role. Interview Process We'll reach out to candidates of interest to schedule an interview. We do our best to communicate outcomes to all applicants by email or phone call. Accommodation TD Bank is an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, age, disability, status as a protected veteran or any other characteristic protected under applicable federal, state, or local law. If you are an applicant with a disability and need accommodations to complete the application process, please email TD Bank US Workplace Accommodations Program at ***************. Include your full name, best way to reach you and the accommodation needed to assist you with the applicant process.

This individual will join the Global Sales team based in Piscataway, promoting IEEE specialty products to academic, government, and corporate organizations. The intern will assist with the following tasks: Assist Sales team with marketing campaigns and sales programs Obtain business intelligence to help develop sales prospects Update contacts, accounts and corporate hierarchies in the CRM system: Salesforce.com Utilize IEEE inhouse reporting tools and business systems to gather information on existing customers Provide data analysis on customer and prospect accounts Qualifications REQUIREMENTS: Rising Junior or Senior with a concentration in Business or Marketing Background in Business is a must with a strong interest in sales. Knowledge working with Salesforce.com and strong profile on LinkedIn is a plus. Must have exceptional high quality written and spoken English skills. Daily contacts with prospects and customers require this candidate to be able to set priorities and communicate effectively in a high volume environment. Self starter with the ability to work independently. Good communicator and good listener - strong ability to build a rapport with prospects on the phone and via e-mail. Well organized. Good planner. Attention to detail. Professional image: Candidate will represent the IEEE brand and be outward facing. Job: Sales Primary Location: United States-New Jersey-Piscataway Schedule: Part-time Job Type: Temporary Job Posting: Dec 23, 2025, 2:35:24 PM

Job Description Are you a dynamic and driven sales professional who thrives on forging new connections and nurturing client relationships? Are you passionate about making a positive impact in people's lives? Do you crave a career that offers both flexibility and autonomy? If you answered "yes" to any of these questions, then RestoreCore has the perfect opportunity for you! About RestoreCore: Imagine working for a family-owned disaster restoration business with over 45 years of experience and a legacy of trust. RestoreCore, with thriving locations across PA, NJ, DE, MD, and the DC-Metro area, is on an exciting journey of growth. We don't just clean up after disasters; we restore homes, businesses, and lives! We're a trusted partner, offering support before, during, and after catastrophes strike, and at the forefront of building these invaluable partnerships is our dedicated Business Development team. Why Join Us: Competitive compensation package including a salary based on your experience and abilities, commission, and KPI-related bonuses. A role that lets you make a real impact by helping individuals and businesses in their time of need. Opportunities for personal and professional growth in a supportive and collaborative work environment. Flexibility and autonomy in your daily work, allowing you to thrive in your role. What You'll Do: Present and sell RestoreCore restoration services in the Central/North Jersey market. Identify and nurture new and existing client relationships in diverse industry verticals, such as commercial property management, multifamily rental housing, senior living, healthcare facilities, hospitality, government, and educational institutions. Meet with prospective and current clients, ranging from on-site staff to C-Suite executives, at various locations and events. Participate in marketing events like tradeshows, happy hours, golf outings, sporting events, etc. Actively engage in industry trade associations and networking groups. Coordinate client training sessions and other opportunities to position RestoreCore as an industry expert and partner. Utilize our company-provided CRM system to log client interactions, manage the opportunities pipeline, and facilitate client forecasting using our proven seven-step sales process. Collaborate closely with the RestoreCore production team to support project sales and ensure client satisfaction from start to finish. Qualifications: Extensive B2B sales experience, preferably within the restoration or property management industry. Established and proven relationships with commercial clients and/or property management professionals. Strong understanding and knowledge of the property management industry, insurance claims industry, and/or the restoration industry. Proven customer service skills in high-stress, fast-paced environments. A minimum of 5 years of outside sales experience. The ability to set and achieve sales targets effectively. Excellent verbal and written communication skills. RestoreCore is an Equal Opportunity employer dedicated to providing fair employment opportunities to all qualified applicants, regardless of race, color, religion, sex, sexual orientation, gender identity or expression, national origin, disability, or protected veteran status. Our commitment is to create an inclusive and respectful work environment for everyone. Please Note: We kindly request that third-party agencies refrain from reaching out regarding this position. We are focused on building direct connections with prospective candidates and prefer to handle the recruitment process in-house. Thank you for your cooperation.

CORE is currently seeking a hardworking and experienced Title Insurance Sales Representative. Join one of South Jersey's fastest growing title companies and most successful title team! Whether you have a well-established client base or need help taking your business to the next level, we want to meet. Increase overall resale and refinance market share in the New Jersey and Pennsylvania market by building strong relationships with REALTORS, mortgage brokers and loan originators, banks, credit unions. Team player who acts as the liaison between the inside office staff and clients in the field. Must be confident in making cold calls, prospecting for leads, as well as maintaining current customer's needs. Strong social media presence is a plus. Develop and initiate new sales and marketing ideas. Actively pursue office presentations with office brokers and staff Knowledge of real estate business is extremely helpful. Consistently increase business and revenues Candidate must possess the following: Strong work ethic. Must provide own reliable transportation. Superior time management skills OTHER REQUIREMENTS: Attending outside functions both during the day and some evenings Excellent interpersonal communication skills (both written and verbal) Ability to effectively present information one-on-one and in group settings Maintain a professional appearance and providing a positive company image EDUCATION: Minimum High School or equivalent (required) Degree in Sales and Marketing (preferred) EXPERIENCE: 2-5 years of successful sales experience in the Real Estate industry Salary is commensurate with experience Job Type: Full-time

Job DescriptionSalary: Gras Lawn, a commercial landscape company, is seeking an experienced Landscape Business Developer for the South Jersey Market. Your main responsibility is developing business with potential new customers, building and maintaining trusted relationships with key decision-makers, understanding their challenges, and creating value solutions. Your role also involves effectively identifying opportunities, gathering valuable intelligence, creating customer-centric proposals, collaborating with team members, meeting specific activity targets, and closing deals. The Business Developer focuses on strengthening Gras Lawns market presence and driving profitable growth. This position plays a key role in meeting long-term strategic objectives by fostering important customer relationships, identifying business opportunities, negotiating and closing deals, and maintaining a comprehensive understanding of the current market landscape. Identifyandunderstandthechallengesofprospectiveclientsanddevelopsolutions. Provideaccurateforecastsforsales,deliverables,andkeyperformanceindicators(KPIs). Achievesalesgoalswhilehavingtheabilitytoworkindependently. Usesalestechniquestofindnewcustomersandbuildlong-termbusinessrelationships.Also,focusonmarketingandpricingstrategies. Conductphoneprospecting,salespresentations,virtualdemonstrations,andcontractnegotiationswithminimalsupervision. Identifycustomerneedsandapplysolution-basedsellingtechniquestodemonstratethevalueof GrasLawnsserviceseffectively. Buildandnurturerelationshipswithpotentialandcurrentclients. Planyourdailyactivitiesandaimtomeetspecificperformancebenchmarkstoclosebusinessdealssuccessfully. ConsistentlyandreliablylogactivitiesintheCRM. Workeffectivelyinafast-pacedenvironmentwhilemaintainingastrongsenseofurgency. Communicateproactivelywithallclients,prospects,andcolleagues. SkillsRequired: ExtensiveexperienceintheCommercialLandscapeIndustry Proventrackrecordofsalesgoalattainmentandpipelinemanagement 3-5yearsofexperienceinB2Bsalesatmid-to-seniorlevels. Localknowledgeandcontactsinoneormoremarketsegments Proficientwithcomputerprograms,including AspireandaCRMtool Highlycompetitive,positive,andresults-driven Exceptionalmultitasker. Excellentoralandwrittencommunicationabilities,strongpresentationskills,andprofessionalexperiencewithsocialmedia. Passionate,organized,andresourcefulindividualwithoutstandinglisteningandinterpersonalskills. Highly organized, self-motivated, and hardworking, with effective time management capabilities. Easilyadaptabletonewsituations. Salary commensurate with experience. Youwillberesponsiblefor: TheBusinessDeveloperoverseesthesalespipelinefromtheprospectingstagetoclosingandisaccountablefortheentiresalescycle,includingsnowsalesincertainregions.Additionally,the BusinessDeveloperworksincollaborationwithpartnersacrossoperations,finance,marketing,andotherdepartmentstoeffectivelyrespondtobidsandachievesalesgoals. Salary commensurate with experience.

Mount Laurel, New Jersey, United States of America **Hours:** 40 **Pay Details:** $92,220 - $149,310 USD TD is committed to providing fair and equitable compensation opportunities to all colleagues. Growth opportunities and skill development are defining features of the colleague experience at TD. Our compensation policies and practices have been designed to allow colleagues to progress through the salary range over time as they progress in their role. The base pay actually offered may vary based upon the candidate's skills and experience, job-related knowledge, geographic location, and other specific business and organizational needs. As a candidate, you are encouraged to ask compensation related questions and have an open dialogue with your recruiter who can provide you more specific details for this role. **Line of Business:** Analytics, Insights, & Artificial Intelligence **:** The Business Insights Specialist is responsible for conducting analyses on curated and/or aggregated DataMart's in conjunction with deep business subject matter expertise, to generate relevant analytical insights for business issues and identify opportunities to drive business growth and value. This role works in partnership with business leaders to present or generate appropriate insights including the delivery of supporting collateral and/or presentations. Job Description **Depth & Scope:** + Works autonomously and accountable for acting as a lead within a specialized business management function and may provide work direction to others + Provides seasoned specialized knowledge, advice and/or guidance to various stakeholders and team members + Scope of role may have enterprise impact + Focuses on short to medium - term issues (e.g. 6-12 months) + Undertakes and completes a variety of complex projects and initiatives requiring specialist knowledge and/or the integration of cross functional processes within own area of expertise + Oversees and/or independently performs tasks from end-to-end + May interact with any hierarchy level up to executive leaders and external vendors **Education & Experience:** + Undergraduate degree or advanced technical degree preferred (e.g., math, physics, engineering, finance or computer science) Graduate's degree preferred with either progressive project work experience, or; + 5+ year of relevant experience; higher degree education and research tenure can be counted **Preferred Skills:** + Experience with PowerBI or Tableau + Data Analytics & Technology Skills + Ability to prioritize and work in a fast-paced environment + Relevant Audit experience is a plus, but not required **Customer Accountabilities:** + Leads on the interpretation of complex business issues, generates multifaceted insights and identifies opportunities to help drive business growth or address business/enterprise needs + Presents and communicates generated insights and recommended business actions to stakeholders/business leaders in an easily digestible manner, leveraging tools/techniques/methods to produce a variety of visualizations/presentations that fit the audience + Acts as the primary interface with business to bridge and translate business requirements to analytics and reporting needs for a given domain/business + Applies collaborative and strong stakeholder management approach to constructively influence and persuade stakeholders and partners where appropriate + Serves as an authority on a given business domain and provides business expertise to place context around analytics discovery and inform recommendations + Escalates data/process related problems and communicates to relevant teams in a timely manner and makes recommendations for resolution + Provides day-to-day support and delivery of analytics **Shareholder Accountabilities:** + Represents functional area as a business insights & analytics specialized expert + Synthesizes complex and vast amount of information and translates into actionable insights and strategy + Builds business requirements and facilitates project execution to develop insights + Collaborates with partners on business challenges and delivers fact-based analytical advice that aligns to strategy and drives shareholder value + Identifies opportunities for business growth within a specific business or function by identifying potential use cases and value drivers + Utilizes both quantitative and qualitative methodologies to interpret and present data effectively and clearly + Works directly with the business teams to gather the demand for analytics and work with the analytics hub to fulfill the analytics demand + Provides business explanation for anomalies/outliers identified during analysis + Works with business functions and analytics teams to transition business requirements to analytics requirements + Trains business users on how to integrate analytics into decisions + Leverages knowledge of data capabilities to build and deliver insights + Develops analysis to corroborate initial proof of concept + Executes on data requests accurately and within a timely manner + Identifies and investigates data/analytics related issues + Ensures business operations are in compliance with applicable internal and external requirements (e.g. financial controls, segregation of duties, transaction approvals and physical control of assets) + Leads/facilitates and/or implements action/remediation plans to address performance/risk/governance issues + Actively manages relationships within and across various business lines, corporate and/or control functions and ensures alignment with enterprise and/or regulatory requirements + Keeps abreast of emerging issues, trends, and evolving regulatory requirements and assesses potential impacts + Maintains a culture of risk management and control, supported by effective processes in alignment with risk appetite **Employee/Team Accountabilities:** + Participates fully as a member of the team, supports a positive work environment that promotes service to the business, quality, innovation and teamwork and ensures timely communication of issues/points of interest + Provides thought leadership and/or industry knowledge for own area of expertise in own area and participates in knowledge transfer within the team and business unit + Keeps current on emerging trends/developments and grows knowledge of the business, related tools and techniques + Participates in personal performance management and development activities, including cross training within own team + Keeps others informed and up to date about the status/progress of projects and/or all relevant or useful information related to day-to-day activities + Contributes to team development of skills and capabilities through mentorship of others, by sharing knowledge and experiences and leveraging best practices + Leads, motivates and develops relationships with internal and external business partners/stakeholders to develop productive working relationships + Contributes to a fair, positive and equitable environment that supports a diverse workforce + Acts as a brand ambassador for your business area/function and the bank, both internally and/or externally + Contribute to data deliverables including Internal, Senior Management, and Audit Committee Reporting + Apply automation and innovation on data platforms to support business function + Design and implement complex business data information management frameworks to provide a solution that meets business requirements + Understand business data and provide analysis and requirements to ensure the data design / development initiatives are in line with the planned design and standards + Conduct meaningful analysis at the functional or enterprise level using results to draw conclusions, make recommendations, assess the effectiveness of programs/ policies/ practices. + Implement continuous process / performance improvements where opportunities exist. \#LI-AMCBCorporate \#IN-AMCBCorporate **Who We Are:** TD is one of the world's leading global financial institutions and is the fifth largest bank in North America by branches/stores. Every day, we deliver legendary customer experiences to over 27 million households and businesses in Canada, the United States and around the world. More than 95,000 TD colleagues bring their skills, talent, and creativity to the Bank, those we serve, and the economies we support. We are guided by our vision to Be the Better Bank and our purpose to enrich the lives of our customers, communities and colleagues. TD is deeply committed to being a leader in customer experience, that is why we believe that all colleagues, no matter where they work, are customer facing. As we build our business and deliver on our strategy, we are innovating to enhance the customer experience and build capabilities to shape the future of banking. Whether you've got years of banking experience or are just starting your career in financial services, we can help you realize your potential. Through regular leadership and development conversations to mentorship and training programs, we're here to support you towards your goals. As an organization, we keep growing - and so will you. **Our Total Rewards Package** Our Total Rewards package reflects the investments we make in our colleagues to help them and their families achieve their financial, physical and mental well-being goals. Total Rewards at TD includes base salary and variable compensation/incentive awards (e.g., eligibility for cash and/or equity incentive awards, generally through participation in an incentive plan) and several other key plans such as health and well-being benefits, savings and retirement programs, paid time off (including Vacation PTO, Flex PTO, and Holiday PTO), banking benefits and discounts, career development, and reward and recognition. Learn more (*************************************** **Additional Information:** We're delighted that you're considering building a career with TD. Through regular development conversations, training programs, and a competitive benefits plan, we're committed to providing the support our colleagues need to thrive both at work and at home. **Colleague Development** If you're interested in a specific career path or are looking to build certain skills, we want to help you succeed. You'll have regular career, development, and performance conversations with your manager, as well as access to an online learning platform and a variety of mentoring programs to help you unlock future opportunities. Whether you have a passion for helping customers and want to expand your experience, or you want to coach and inspire your colleagues, there are many different career paths within our organization at TD - and we're committed to helping you identify opportunities that support your goals. **Training & Onboarding** We will provide training and onboarding sessions to ensure that you've got everything you need to succeed in your new role. **Interview Process** We'll reach out to candidates of interest to schedule an interview. We do our best to communicate outcomes to all applicants by email or phone call. **Accommodation** TD Bank is an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, age, disability, status as a protected veteran or any other characteristic protected under applicable federal, state, or local law. If you are an applicant with a disability and need accommodations to complete the application process, please email TD Bank US Workplace Accommodations Program at *************** . Include your full name, best way to reach you and the accommodation needed to assist you with the applicant process. Federal law prohibits job discrimination based on race, color, sex, sexual orientation, gender identity, national origin, religion, age, equal pay, disability and genetic information.

Part-time Description The Hun School of Princeton seeks a Business Office Accounting Intern to assist with daily accounting activities, correspondence, organization, and general business office tasks. The accounting intern can expect to learn and participate in financial data preparation, create, maintain and track data in various software programs, assist with the advancement of the accounting system, basic general ledger functions, billing, and other general accounting activities. This position reports to the Controller, is part time, (paid) non-exempt, and will work five (5) days per week (Monday through Friday) and five (5) hours per day; hours worked can be flexible within the School's business hours (8am to 4pm) for a total of twenty-five (25) hours per week. Responsibilities and Essential functions: Shadow members of the business office as they perform their duties; Learn the accounting basics of working as a part of the business office team to compile and analyze data, track information and support the School community; Assist with research, data entry, recording, tracking, and maintenance of accurate account documentation and financial records; Identify, research and resolve discrepancies and issues; Prepare monthly reconciliations of general ledger balances for analysis; Develop and execute correspondence for billing, collections and other accounting activities requiring a high volume of (verbal and written) contact; Maintain excel spreadsheets to provide detail reporting and follow up related to accounting system; Work to understand the mapping of reports in the system to provide needed information to all departments for actual and budget reporting; Back up front desk staff to cover vacations/sick time; Perform tasks which are supportive in nature to the essential functions of the job, which may be altered or redesigned as necessary. Requirements Recent graduate or actively working towards a degree in accounting or relevant degree; Strong understanding of accounting and financial principles; Excellent technology skills including Microsoft Office suite, advanced Excel skills, and Google Mail (Gmail) applications are required; Detail oriented as well as thorough and accurate; Must possess good judgment, tact, sensitivity, and discretion with confidential information, materials and situations; Comfortable working in a fast paced and dynamic school atmosphere; Collaboration and teamwork skills; Good social skills and the ability to interact and work within a diverse community including co-workers, staff, faculty, students, alumni and parents; Must be fingerprinted and pass the State of New Jersey criminal background check. Hourly Rate Range: $22.50 to $25 per hour Eligible employees receive a robust benefits package that includes health, dental, vision, and prescription insurance coverage, retirement plan options with a school matching program, life and disability insurance, opportunities for professional development, and a variety of other valuable programs and benefits designed to enhance employee well-being. The Hun School of Princeton is an E-Verify employer. Information regarding E-Verify can be found here: E-Verify.gov. To Apply: The Hun School of Princeton Employment Application ABOUT THE HUN SCHOOL The Hun School of Princeton is a co-educational, private day and boarding school in Princeton, New Jersey. Individual attention and strong student-faculty relationships are the hallmarks of the School. On the 50-acre campus between Philadelphia and New York City, student-centered, hands-on learning prepares students for the global community in which they will live and work. The Hun School is comprised of nearly 700 students in its Middle School, Upper School, and Postgraduate Program. Our campus is home to students from twenty-two countries and fifteen states. Our campus is located in historic Princeton, New Jersey, a short train ride away from both New York City (50 miles) and Philadelphia (45 miles). Home to Princeton University, The Institute for Advanced Study, Princeton Theological Seminary, and an array of cultural centers and organizations, Princeton is regarded as one of the most academically-minded communities in the world. Often named one of the country's best places to live, Princeton is a friendly, multicultural community surrounded by mountains, parks, and lakes. There are award-winning museums and theatres, celebrated public and private schools, destination restaurants and hotels, and a robust calendar of community events to enjoy. Our mission: The Hun School of Princeton empowers each student to thrive in a diverse and ever-changing world, by nurturing resilient character, providing individual mentorship, and inspiring vigorous and joyful learning. Our community: In our mission of educating global citizens with resilient character, we actively seek candidates who can bring a diversity of experiences and perspectives to our community. The Hun School of Princeton is an equal opportunity employer and does not discriminate in employment opportunities or practices on the basis of race, color, religion, sex, sexual orientation, national origin, age, disability, or any other characteristics or activity protected by law. The Hun School of Princeton is an E-Verify employer. Information regarding E-Verify can be found here: E-Verify.gov.

Founded in Denmark, Ramboll is a foundation-owned people company. We have more than 18,000 experts working across our global operations in 35 countries with thousands of experts working across 70 offices in the Americas. Our experts are leaders in their fields, developing and delivering innovative solutions in diverse markets including Buildings, Transport, Planning & Urban Design, Water, Environment & Health, Energy, and Management Consulting. We invite you to contribute to a more sustainable future working in an open, collaborative, and empowering company. Combining local experience with global knowledge, we together shape the societies of tomorrow. Job Description Job location: Albany, NY, Princeton, NJ, or Blue Bell, PA. Are you eager to develop your excellence in an inclusive, collaborative, and empowering community? Are you excited about joining a company that strives to make a difference - for its employees, clients, and society? Are you motivated by creating sustainable change that benefits society and nature? If this sounds interesting to you, or you're curious to learn more, then this role could be the perfect opportunity for you. Join our team and work with us to close the gap to a sustainable future. Your new role As our new Managing Consultant with air quality compliance & permitting consulting experience, you will be part of Ramboll's Environment & Health Division. This group consists of people who are passionate about air quality, and other environmental regulatory compliance, while assisting Ramboll's clients with their most challenging problems. The services and support provided to our clients within various industries range across a variety of topics, including but not limited to air permit applications, emissions estimation, preparation of air compliance related reports, air dispersion modeling, and general regulatory compliance. Your key tasks and responsibilities will be: Critically reviewing and interpreting local, state, and federal environmental regulations, with focus on air compliance Maintaining client relationships and managing the development of deliverables to meet client needs in an efficient manner Serving as the technical lead overseeing Consultant-level staff on complex projects Estimating emissions and conducting engineering evaluations of air pollution sources Supporting air dispersion modeling of air pollution dispersion Preparing all levels of air quality permit applications and environmental reports EPCRA Tier II and TRI Reporting Other environmental regulatory compliance experience consider a plus Your new team As part of the team, you will be part of a creative group, filled with people who are really excited about solving clients' problems and creating sustainable solutions for them. You will work with all levels of technical expertise from entry level team members to members with decades of experience, many of whom are subject matter experts in their own fields. And you will engage in a continual learning environment through coaching, mentoring, and on the job tasks. About you From the moment you join Ramboll, we will support your personal and professional development so that you grow with the company. For this role, we believe your starting point is: B.S. or M.S. in Chemical, Mechanical, Civil, or Environmental Engineering or science discipline (air quality course work is a plus) 9+ years of air quality related experience Strong computing skills including high level use of spreadsheets and word processing Strong written/verbal communication, problem-solving and organization skills Demonstrated capabilities in understanding, interpreting, and applying environmental regulations to real-world situations Programming, database and GIS skills are preferred but not required What we can offer you Interesting and diverse projects The opportunity to work with some of the best and brightest professionals in your field Flexible work arrangements Generous Paid Time Off Excellent health and retirement benefits Investment in your development Leaders you can count on, guided by our Leadership Principles Appreciation for the unique person you are The long-term thinking of a foundation-owned company Inspiration from colleagues, clients, and projects Salary Transparency Statement At Ramboll, your base pay is only part of your overall total compensation package. At the time of this posting, this role is likely to be compensated at an annual base salary in the New York area between $114,000 and $143,000. Actual pay may be more or less than the posted range, depending on numerous factors, including experience, geographical location, internal equity, market conditions, education/training and skill level, and does not include bonuses, overtime, or other forms of compensation or benefits. Work at the heart of sustainable change Ramboll is a global architecture, engineering, and consultancy company. We believe that the purpose of sustainable change is to create a thriving world for both nature and people. So, that's where we start - and how we work. At Ramboll, our core strength is our people, and our history is rooted in a clear vision of how a responsible company should act. Being open and curious is a cornerstone of our culture. We embrace an inclusive mindset that looks for fresh, diverse, and innovative perspectives. We respect, embrace, and invite diversity in all forms to actively cultivate an environment where everyone can flourish and realize their full potential. Ready to join us? Please submit your application. Be sure to include all relevant documents including your CV and a cover letter connecting your background to the responsibilities of the position. Please note, applicants must be currently authorized to work in the United States on a full-time basis. No sponsorship is available for this position. We recognize that some candidates only apply when they tick every box. However, passion and potential often outweigh a perfect resume and Ramboll's supportive learning culture can help you grow. So, if this role resonates with you but you don't meet all the requirements, we encourage you to apply. You might be the perfect fit for this opportunity or another within our team. Thank you for taking the time to apply, we look forward to receiving your application! An equal opportunity employer Equality, diversity, and inclusion is at the heart of what we do. At Ramboll, we believe that diversity is a strength, and that different experiences and perspectives are essential to creating truly sustainable societies. We invite applications from candidates of all backgrounds, regardless of age, disability or medical condition, gender identity, marriage and domestic partnership, pregnancy and maternity, race, ancestry, or national origin, religion or belief, sex and sexual orientation, military service and veteran status, or any other protected characteristic Additional Information All your information will be kept confidential according to EEO guidelines.

BraveView has been engaged by a growing $14mm Commercial Landscape company in the Piscataway, NJ market to recruit and hire an experienced Business Developer to join their organization. Ideally, this person should target the Northern part of the NJ market and look for opportunities that fit our company's criteria. Title: Business Developer Category: Full Time, Salary Salary: $75,000 - $85,000 based on skill & experience plus sales commissions. Job Summary: The Commercial Landscape Business Developer is responsible for driving revenue growth by identifying, pursuing, and securing commercial landscape maintenance contracts. This role focuses on building and maintaining strong client relationships, generating leads, and closing sales for landscape maintenance services. The ideal candidate is a proactive, results-driven professional with strong sales skills and knowledge of the landscaping industry. Key Responsibilities: Lead Generation: Identify and target potential commercial clients, such as property managers, HOAs, corporate campuses, retail centers, and municipalities, through cold calling, networking, referrals, and industry events. Client Relationship Management: Build and maintain long-term relationships with clients, understanding their needs and providing tailored landscape maintenance solutions. Sales Process: Develop and present proposals, negotiate contract terms, and close deals for recurring maintenance contracts and additional services. Market Research: Stay informed about industry trends, competitor offerings, and local market opportunities to position the company competitively. Site Assessments: Conduct site visits to evaluate client properties, assess landscaping needs, and provide accurate cost estimates and service plans. Collaboration: Work closely with operations and account management teams to ensure seamless service delivery and client satisfaction post-sale. CRM Management: Maintain accurate records of sales activities, client interactions, and pipeline progress using CRM software. Revenue Goals: Meet or exceed quarterly and annual sales targets for maintenance contracts and upsell opportunities. Qualifications: Bachelor's degree in business, horticulture, landscape management, or related field (preferred but not required). 3+ years of B2B sales experience, preferably in landscaping, facilities management, or a related industry. Strong understanding of commercial landscaping services, including maintenance, irrigation, and seasonal care. Proven track record of meeting or exceeding sales quotas. Excellent communication, negotiation, and presentation skills. Ability to build rapport and trust with diverse clients, including property managers, HOA boards and corporate decision-makers. Proficiency in CRM software and Microsoft Office. Valid driver's license and ability to travel to client sites. Preferred Skills: Knowledge of local plants, climate, and landscaping best practices. Experience in creating and delivering compelling proposals and bids. Familiarity with commercial property management or real estate sectors. Compensation & Benefits: Competitive base salary plus commission. Health, dental, and vision insurance. Company vehicle or mileage reimbursement. Paid time off and holidays. 401k Opportunities for professional development and career growth. If you are qualified and interested, please respond to this job posting by sending us a copy of your resume. #ZR

Job Description BraveView has been engaged by a growing $14mm Commercial Landscape company in the Piscataway, NJ market to recruit and hire an experienced Business Developer to join their organization. Ideally, this person should target the Northern part of the NJ market and look for opportunities that fit our company's criteria. Title: Business Developer Category: Full Time, Salary Salary: $75,000 - $85,000 based on skill & experience plus sales commissions. Job Summary: The Commercial Landscape Business Developer is responsible for driving revenue growth by identifying, pursuing, and securing commercial landscape maintenance contracts. This role focuses on building and maintaining strong client relationships, generating leads, and closing sales for landscape maintenance services. The ideal candidate is a proactive, results-driven professional with strong sales skills and knowledge of the landscaping industry. Key Responsibilities: Lead Generation: Identify and target potential commercial clients, such as property managers, HOAs, corporate campuses, retail centers, and municipalities, through cold calling, networking, referrals, and industry events. Client Relationship Management: Build and maintain long-term relationships with clients, understanding their needs and providing tailored landscape maintenance solutions. Sales Process: Develop and present proposals, negotiate contract terms, and close deals for recurring maintenance contracts and additional services. Market Research: Stay informed about industry trends, competitor offerings, and local market opportunities to position the company competitively. Site Assessments: Conduct site visits to evaluate client properties, assess landscaping needs, and provide accurate cost estimates and service plans. Collaboration: Work closely with operations and account management teams to ensure seamless service delivery and client satisfaction post-sale. CRM Management: Maintain accurate records of sales activities, client interactions, and pipeline progress using CRM software. Revenue Goals: Meet or exceed quarterly and annual sales targets for maintenance contracts and upsell opportunities. Qualifications: Bachelor's degree in business, horticulture, landscape management, or related field (preferred but not required). 3+ years of B2B sales experience, preferably in landscaping, facilities management, or a related industry. Strong understanding of commercial landscaping services, including maintenance, irrigation, and seasonal care. Proven track record of meeting or exceeding sales quotas. Excellent communication, negotiation, and presentation skills. Ability to build rapport and trust with diverse clients, including property managers, HOA boards and corporate decision-makers. Proficiency in CRM software and Microsoft Office. Valid driver's license and ability to travel to client sites. Preferred Skills: Knowledge of local plants, climate, and landscaping best practices. Experience in creating and delivering compelling proposals and bids. Familiarity with commercial property management or real estate sectors. Compensation & Benefits: Competitive base salary plus commission. Health, dental, and vision insurance. Company vehicle or mileage reimbursement. Paid time off and holidays. 401k Opportunities for professional development and career growth. If you are qualified and interested, please respond to this job posting by sending us a copy of your resume. #ZR

Job DescriptionDescription: About Us: Approved Fire Protection Co. is New Jersey's oldest family-owned, full-service fire protection and safety equipment company. Our services include fire extinguishers, alarm systems, suppression systems, SCBA, gas detection, carbon dioxide, oxygen, sprinkler systems, access control, CCTV, and so much more. Approved Fire Protection's mission is to supply life safety and security products and services to the industrial, commercial, pharmaceutical, and municipal companies in New Jersey and near surrounding areas. Job Summary: We are seeking a driven, high-energy New Business Sales Representative to aggressively grow our portable gas meter, SCBA, & PPE divisions. This role is focused on pure hunting and outbound prospecting, building new relationships, driving first-time appointments, and converting opportunities into revenue. The ideal candidate thrives on activity, embraces cold outreach, and excels at opening new doors through phone calls, LinkedIn messaging, email campaigns, networking, and in-person site visits.This individual will represent our full line of SCBA, portable gas meters, and PPE products and services-while educating customers on compliance, safety, and risk reduction. Success in this role is measured by daily/weekly outbound activity, KPI targets, pipeline growth, and consistent quota attainment. If you are competitive, motivated by new business generation, and excel in fast-paced sales environments, this position offers strong earning potential, autonomy, and the opportunity to make a meaningful impact on customer safety and security. Benefits: Medical, Dental, Vision, HSA 401k with company contributions Life Insurance Long term disability Long Term Care Insurance Summer Hours Program Profit Sharing Mileage Reimbursement PTO Salary: $55k - $65K base salary plus uncapped commissions, car package, bonus, profit sharing Requirements: Prior experience in the fire protection industry or PPE sales is preferred. Prior outside sales experience is a MUST. Able to travel to customer sites throughout your territory. Excellent communication, negotiation, and interpersonal skills via email, text message, a phone. Valid driver's license and excellent driving record. Must pass a background check and pre-employment drug screen. Excellent customer service skills. Continuing education as training/ seminars arises Must be able to work Monday through Friday 7:20 am - 4:20 PM Language: Must be able to read, write in English

Responsibilities Include: * Understanding of client business objective, challenges, scope, business outcome through cloud and AI enablement * Conduct advisory engagements - Cloud / Data Architecture, Industry Cloud, Mergers / Divestitures, Optimization / Operating Model, Ecosystem Integration * Assess existing IT infrastructure and determine cloud migration suitability * Provide technical guidance for cloud platform selection and migration * Develop hybrid cloud roadmaps and strategies for clients, conduct comprehensive cloud assessments, distributed cloud architecture design and create implementation plan and roadmap * Maintain client stakeholder relationship, identify downstream opportunities, ensure closure of advisory commitments * Conduct cost optimization analyses, identify opportunities to reduce cloud spending, maximize return on cloud investments * Ensure security and regulatory compliance, provide training and education to client on cloud technologies Mandatory Skills * 10-16 years of relevant experience * Cloud certification / advanced cloud certification * Previous cloud delivery engagement experience * Business understanding of Industry processes, Mergers and divestitures, operating model post cloud adoption, data structures, data availability assessment and AI enablement * Technical Proficiency in one / multiple of the following technology spaces - distributed cloud architecture design, migration and modernization techniques, microservices and serverless architecture, API and integration techniques, DevSecOps, cloud native services, cloud resource optimization and FinOps techniques Desired Skills * Ability to translate technical concepts for non-technical audiences * Adaptability to emerging technologies * Customer-centric mindset * Working in cross functional teams * Effective presentation capabilities * Local and regulatory compliance and Industry standards Salary Range: $153,000-$180,000 a year #LI-AK1

Hours: 40 Pay Details: $122,304 - $199,680 USD TD is committed to providing fair and equitable compensation opportunities to all colleagues. Growth opportunities and skill development are defining features of the colleague experience at TD. Our compensation policies and practices have been designed to allow colleagues to progress through the salary range over time as they progress in their role. The base pay actually offered may vary based upon the candidate's skills and experience, job-related knowledge, geographic location, and other specific business and organizational needs. As a candidate, you are encouraged to ask compensation related questions and have an open dialogue with your recruiter who can provide you more specific details for this role. Line of Business: Analytics, Insights, & Artificial Intelligence Job Description: Department Overview:ORM Lead Business Insights Specialist, Stress Testing & Scenario Analysis will serve as a key resource leading ORM's stress testing and scenario analysis program. This role requires ability to execute advanced quantitative modeling along with managing high-stakes regulatory governance.The Lead Business Insights Specialist acts as an advisor to business leaders and stakeholders. This role provides comprehensive analytical support, interpretation of complex data, BI or analytics outcomes to generate multidimensional insights that drive business growth and value. This role works in partnership with business leaders to present or generate appropriate insights including the delivery of supporting collateral and/or presentations.Depth & Scope: Generally accountable for a significant business or area that has cross business or enterprise-wide impact or accountability Enterprise domain/functional and deep specialized knowledge at the enterprise, business, regulatory and industry levels Undertakes and completes a variety of complex initiatives requiring seasoned specialist knowledge and/or the integration of cross functional processes Typically deals with senior/executive management Focuses on longer-range planning for functional area (e.g. 12 months or greater) May manage and prioritize multiple projects at a given time May interact with any hierarchy level up to executive leaders and external vendors Primary Accountabilities: Regulatory Execution: Lead the end-to-end delivery of the ORM Stress Testing Program, ensuring all regulatory requirements for operational risk losses and capital are met within required timelines. Scope: Manage the execution of: US Regulatory: Dodd-Frank Act Stress Testing (DFAST) and Comprehensive Capital Analysis and Review (CCAR). Canadian Regulatory: OSFI Macro Stress Test (MST). Internal: Annual Enterprise-wide Stress Test (EWST) and ad-hoc requests. Scenario Analysis: Lead the development and implementation of the Scenario Analysis program, ensuring alignment with enterprise standards and regulatory requirements. Methodology & Documentation: Aid in the development and execution of the methodology, procedures, and documentation for operational risk stress testing programs. Collaboration: Partner extensively with key stakeholders to ensure program success, including Model Development and Model Validation, ORM Internal Loss Event Data team, Enterprise Capital Stress Testing, US CCAR Governance team, Finance, Regulators, and External Consultants Advanced Analytics: Utilize Python to handle large datasets and apply modeling techniques such as Loss Distribution Approach (LDA), Regression Modeling, and Scenario Analysis to forecast losses. Process Automation: Design and deploy Power Automate flows to streamline data collection from stakeholders (e.g., Scenario Analysis workshops) and automate approval workflows. Reporting & Visualization: Build and maintain Power BI dashboards to visualize stress test results and scenario impacts for senior management and the US CCAR Governance team. Preferred Qualifications: 5+ years of experience in stress testing (CCAR/DFAST), operational risk modeling, or capital planning. Experience with OSFI (Canada) regulatory requirements is a strong asset, in addition to US Fed requirements. Master's degree in a quantitative discipline (Finance, Statistics, Economics, Data Science). Proficient in data manipulation (Pandas) and statistical modeling. Advanced skills in Power BI (reporting) and Power Automate (workflow optimization). Deep understanding of operational risk capital methodologies (LDA, Monte Carlo, Frequency/Severity modeling). Proven ability to manage regulatory relationships and defend methodologies to Model Validation and Audit. Strong leadership skills to oversee a focused team of professionals. Education & Experience: Undergraduate degree or advanced technical degree preferred (e.g., math, physics, engineering, finance or computer science) Graduate's degree preferred with either progressive project work experience, or; 7+ year of relevant experience; higher degree education and research tenure can be counted Customer Accountabilities: Leads on the interpretation of complex business issues, generates multifaceted insights and identifies opportunities to help drive business growth or address business/enterprise needs Presents and communicates generated insights and recommended business actions to stakeholders/business leaders in an easily digestible manner, leveraging tools/techniques/methods to produce a variety of visualizations/presentations that fit the audience Acts as the primary interface with business to bridge and translate business requirements to analytics and reporting needs for a given domain/business Applies collaborative and strong stakeholder management approach to constructively influence and persuade stakeholders and partners where appropriate Serves as an authority on a given business domain and provides business expertise to place context around analytics discovery and inform recommendations Escalates data/process related problems and communicates to relevant teams in a timely manner and makes recommendations for resolution Provides day-to-day support and delivery of analytics Shareholder Accountabilities: Represents functional area as a business insights & analytics specialized expert Synthesizes complex and vast amount of information and translates into actionable insights and strategy Builds business requirements and facilitates project execution to develop insights Collaborates with partners on business challenges and delivers fact-based analytical advice that aligns to strategy and drives shareholder value Identifies opportunities for business growth within a specific business or function by identifying potential use cases and value drivers Utilizes both quantitative and qualitative methodologies to interpret and present data effectively and clearly Works directly with the business teams to gather the demand for analytics and work with the analytics hub to fulfill the analytics demand Provides business explanation for anomalies/outliers identified during analysis Works with business functions and analytics teams to transition business requirements to analytics requirements Trains business users on how to integrate analytics into decisions Leverages knowledge of data capabilities to build and deliver insights Develops analysis to corroborate initial proof of concept Executes on data requests accurately and within a timely manner Identifies and investigates data/analytics related issues Ensures business operations are in compliance with applicable internal and external requirements (e.g. financial controls, segregation of duties, transaction approvals and physical control of assets) Leads/facilitates and/or implements actions/remediation plans to address performance/risk/governance issues Actively manages relationships within and across various business lines, corporate and/or control functions and ensures alignment with enterprise and/or regulatory requirements Keeps abreast of emerging issues, trends, and evolving regulatory requirements and assesses potential impacts Maintains a culture of risk management and control, supported by effective processes in alignment with risk appetite Employee/Team Accountabilities: Participates fully as a member of the team, supports a positive work environment that promotes service to the business, quality, innovation and teamwork and ensures timely communication of issues/points of interest Provides thought leadership and/or industry knowledge for own area of expertise in own area and participates in knowledge transfer within the team and business unit Keeps current on emerging trends/developments and grows knowledge of the business, related tools and techniques Participates in personal performance management and development activities, including cross training within own team Keeps others informed and up to date about the status/progress of projects and/or all relevant or useful information related to day-to-day activities Contributes to team development of skills and capabilities through mentorship of others, by sharing knowledge and experiences and leveraging best practices Leads, motivates and develops relationships with internal and external business partners/stakeholders to develop productive working relationships Contributes to a fair, positive and equitable environment that supports a diverse workforce Acts as a brand ambassador for your business area/function and the bank, both internally and/or externally Physical Requirements:Never: 0%; Occasional: 1-33%; Frequent: 34-66%; Continuous: 67-100% Domestic Travel - Occasional International Travel - Never Performing sedentary work - Continuous Performing multiple tasks - Continuous Operating standard office equipment - Continuous Responding quickly to sounds - Occasional Sitting - Continuous Standing - Occasional Walking - Occasional Moving safely in confined spaces - Occasional Lifting/Carrying (under 25 lbs.) - Occasional Lifting/Carrying (over 25 lbs.) - Never Squatting - Occasional Bending - Occasional Kneeling - Never Crawling - Never Climbing - Never Reaching overhead - Never Reaching forward - Occasional Pushing - Never Pulling - Never Twisting - Never Concentrating for long periods of time - Continuous Applying common sense to deal with problems involving standardized situations - Continuous Reading, writing and comprehending instructions - Continuous Adding, subtracting, multiplying and dividing - Continuous The above statements are intended to describe the general nature and level of work being performed by people assigned to this job. They are not intended to be an exhaustive list of all responsibilities, duties and skills required. The listed or specified responsibilities & duties are considered essential functions for ADA purposes.#LI-AMCBCorporate Who We Are: TD is one of the world's leading global financial institutions and is the fifth largest bank in North America by branches/stores. Every day, we deliver legendary customer experiences to over 27 million households and businesses in Canada, the United States and around the world. More than 95,000 TD colleagues bring their skills, talent, and creativity to the Bank, those we serve, and the economies we support. We are guided by our vision to Be the Better Bank and our purpose to enrich the lives of our customers, communities and colleagues. TD is deeply committed to being a leader in customer experience, that is why we believe that all colleagues, no matter where they work, are customer facing. As we build our business and deliver on our strategy, we are innovating to enhance the customer experience and build capabilities to shape the future of banking. Whether you've got years of banking experience or are just starting your career in financial services, we can help you realize your potential. Through regular leadership and development conversations to mentorship and training programs, we're here to support you towards your goals. As an organization, we keep growing - and so will you. Our Total Rewards Package Our Total Rewards package reflects the investments we make in our colleagues to help them and their families achieve their financial, physical and mental well-being goals. Total Rewards at TD includes base salary and variable compensation/incentive awards (e.g., eligibility for cash and/or equity incentive awards, generally through participation in an incentive plan) and several other key plans such as health and well-being benefits, savings and retirement programs, paid time off (including Vacation PTO, Flex PTO, and Holiday PTO), banking benefits and discounts, career development, and reward and recognition. Learn more Additional Information: We're delighted that you're considering building a career with TD. Through regular development conversations, training programs, and a competitive benefits plan, we're committed to providing the support our colleagues need to thrive both at work and at home. Colleague Development If you're interested in a specific career path or are looking to build certain skills, we want to help you succeed. You'll have regular career, development, and performance conversations with your manager, as well as access to an online learning platform and a variety of mentoring programs to help you unlock future opportunities. Whether you have a passion for helping customers and want to expand your experience, or you want to coach and inspire your colleagues, there are many different career paths within our organization at TD - and we're committed to helping you identify opportunities that support your goals. Training & Onboarding We will provide training and onboarding sessions to ensure that you've got everything you need to succeed in your new role. Interview Process We'll reach out to candidates of interest to schedule an interview. We do our best to communicate outcomes to all applicants by email or phone call. Accommodation TD Bank is an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, age, disability, status as a protected veteran or any other characteristic protected under applicable federal, state, or local law. If you are an applicant with a disability and need accommodations to complete the application process, please email TD Bank US Workplace Accommodations Program at ***************. Include your full name, best way to reach you and the accommodation needed to assist you with the applicant process.

Mount Laurel, New Jersey, United States of America **Hours:** 40 **Pay Details:** $122,304 - $199,680 USD TD is committed to providing fair and equitable compensation opportunities to all colleagues. Growth opportunities and skill development are defining features of the colleague experience at TD. Our compensation policies and practices have been designed to allow colleagues to progress through the salary range over time as they progress in their role. The base pay actually offered may vary based upon the candidate's skills and experience, job-related knowledge, geographic location, and other specific business and organizational needs. As a candidate, you are encouraged to ask compensation related questions and have an open dialogue with your recruiter who can provide you more specific details for this role. **Line of Business:** Analytics, Insights, & Artificial Intelligence **Job Description:** **Department Overview** **:** **ORM Lead Business Insights Specialist, Stress Testing & Scenario Analysis will serve as a key resource leading ORM's stress testing and scenario analysis program. This role requires ability to execute advanced quantitative modeling along with managing high-stakes regulatory governance.** **The Lead Business Insights Specialist acts as an advisor to business leaders and stakeholders. This role provides comprehensive analytical support, interpretation of complex data, BI or analytics outcomes to generate multidimensional insights that drive business growth and value. This role works in partnership with business leaders to present or generate appropriate insights including the delivery of supporting collateral and/or presentations.** **Depth & Scope** **:** **Generally accountable for a significant business or area that has cross business or enterprise-wide impact or accountability** **Enterprise domain/functional and deep specialized knowledge at the enterprise, business, regulatory and industry levels** **Undertakes and completes a variety of complex initiatives requiring seasoned specialist knowledge and/or the integration of cross functional processes** **Typically deals with senior/executive management** **Focuses on longer-range planning for functional area (e.g. 12 months or greater)** **May manage and prioritize multiple projects at a given time** **May interact with any hierarchy level up to executive leaders and external vendors** **Primary Accountabilities** **:** **Regulatory Execution: Lead the end-to-end delivery of the ORM Stress Testing Program, ensuring all regulatory requirements for operational risk losses and capital are met within required timelines.** **Scope: Manage the execution of:** **US Regulatory: Dodd-Frank Act Stress Testing (DFAST) and Comprehensive Capital Analysis and Review (CCAR).** **Canadian Regulatory: OSFI Macro Stress Test (MST).** **Internal: Annual Enterprise-wide Stress Test (EWST) and ad-hoc requests.** **Scenario Analysis: Lead the development and implementation of the Scenario Analysis program, ensuring alignment with enterprise standards and regulatory requirements.** **Methodology & Documentation: Aid in the development and execution of the methodology, procedures, and documentation for operational risk stress testing programs.** **Collaboration: Partner extensively with key stakeholders to ensure program success, including Model Development and Model Validation, ORM Internal Loss Event Data team, Enterprise Capital Stress Testing, US CCAR Governance team, Finance, Regulators, and External Consultants** **Advanced Analytics: Utilize Python to handle large datasets and apply modeling techniques such as Loss Distribution Approach (LDA), Regression Modeling, and Scenario Analysis to forecast losses.** **Process Automation: Design and deploy Power Automate flows to streamline data collection from stakeholders (e.g., Scenario Analysis workshops) and automate approval workflows.** **Reporting & Visualization: Build and maintain Power BI dashboards to visualize stress test results and scenario impacts for senior management and the US CCAR Governance team.** **Preferred Qualifications** **:** **5+ years of experience in stress testing (CCAR/DFAST), operational risk modeling, or capital planning.** **Experience with OSFI (Canada) regulatory requirements is a strong asset, in addition to US Fed requirements.** **Master's degree in a quantitative discipline (Finance, Statistics, Economics, Data Science).** **Proficient in data manipulation (Pandas) and statistical modeling.** **Advanced skills in Power BI (reporting) and Power Automate (workflow optimization).** **Deep understanding of operational risk capital methodologies (LDA, Monte Carlo, Frequency/Severity modeling).** **Proven ability to manage regulatory relationships and defend methodologies to Model Validation and Audit.** **Strong leadership skills to oversee a focused team of professionals.** **Education & Experience** **:** **Undergraduate degree or advanced technical degree preferred (e.g., math, physics, engineering, finance or computer science) Graduate's degree preferred with either progressive project work experience, or;** **7+ year of relevant experience; higher degree education and research tenure can be counted** **Customer Accountabilities** **:** **Leads on the interpretation of complex business issues, generates multifaceted insights and identifies opportunities to help drive business growth or address business/enterprise needs** **Presents and communicates generated insights and recommended business actions to stakeholders/business leaders in an easily digestible manner, leveraging tools/techniques/methods to produce a variety of visualizations/presentations that fit the audience** **Acts as the primary interface with business to bridge and translate business requirements to analytics and reporting needs for a given domain/business** **Applies collaborative and strong stakeholder management approach to constructively influence and persuade stakeholders and partners where appropriate** **Serves as an authority on a given business domain and provides business expertise to place context around analytics discovery and inform recommendations** **Escalates data/process related problems and communicates to relevant teams in a timely manner and makes recommendations for resolution** **Provides day-to-day support and delivery of analytics** **Shareholder Accountabilities** **:** **Represents functional area as a business insights & analytics specialized expert** **Synthesizes complex and vast amount of information and translates into actionable insights and strategy** **Builds business requirements and facilitates project execution to develop insights** **Collaborates with partners on business challenges and delivers fact-based analytical advice that aligns to strategy and drives shareholder value** **Identifies opportunities for business growth within a specific business or function by identifying potential use cases and value drivers** **Utilizes both quantitative and qualitative methodologies to interpret and present data effectively and clearly** **Works directly with the business teams to gather the demand for analytics and work with the analytics hub to fulfill the analytics demand** **Provides business explanation for anomalies/outliers identified during analysis** **Works with business functions and analytics teams to transition business requirements to analytics requirements** **Trains business users on how to integrate analytics into decisions** **Leverages knowledge of data capabilities to build and deliver insights** **Develops analysis to corroborate initial proof of concept** **Executes on data requests accurately and within a timely manner** **Identifies and investigates data/analytics related issues** **Ensures business operations are in compliance with applicable internal and external requirements (e.g. financial controls, segregation of duties, transaction approvals and physical control of assets)** **Leads/facilitates and/or implements actions/remediation plans to address performance/risk/governance issues** **Actively manages relationships within and across various business lines, corporate and/or control functions and ensures alignment with enterprise and/or regulatory requirements** **Keeps abreast of emerging issues, trends, and evolving regulatory requirements and assesses potential impacts** **Maintains a culture of risk management and control, supported by effective processes in alignment with risk appetite** **Employee/Team Accountabilities** **:** **Participates fully as a member of the team, supports a positive work environment that promotes service to the business, quality, innovation and teamwork and ensures timely communication of issues/points of interest** **Provides thought leadership and/or industry knowledge for own area of expertise in own area and participates in knowledge transfer within the team and business unit** **Keeps current on emerging trends/developments and grows knowledge of the business, related tools and techniques** **Participates in personal performance management and development activities, including cross training within own team** **Keeps others informed and up to date about the status/progress of projects and/or all relevant or useful information related to day-to-day activities** **Contributes to team development of skills and capabilities through mentorship of others, by sharing knowledge and experiences and leveraging best practices** **Leads, motivates and develops relationships with internal and external business partners/stakeholders to develop productive working relationships** **Contributes to a fair, positive and equitable environment that supports a diverse workforce** **Acts as a brand ambassador for your business area/function and the bank, both internally and/or externally** **Physical Requirements** **:** **Never: 0%; Occasional: 1-33%; Frequent: 34-66%; Continuous: 67-100%** **Domestic Travel - Occasional** **International Travel - Never** **Performing sedentary work - Continuous** **Performing multiple tasks - Continuous** **Operating standard office equipment - Continuous** **Responding quickly to sounds - Occasional** **Sitting - Continuous** **Standing - Occasional** **Walking - Occasional** **Moving safely in confined spaces - Occasional** **Lifting/Carrying (under 25 lbs.) - Occasional** **Lifting/Carrying (over 25 lbs.) - Never** **Squatting - Occasional** **Bending - Occasional** **Kneeling - Never** **Crawling - Never** **Climbing - Never** **Reaching overhead - Never** **Reaching forward - Occasional** **Pushing - Never** **Pulling - Never** **Twisting - Never** **Concentrating for long periods of time - Continuous** **Applying common sense to deal with problems involving standardized situations - Continuous** **Reading, writing and comprehending instructions - Continuous** **Adding, subtracting, multiplying and dividing - Continuous** **The above statements are intended to describe the general nature and level of work being performed by people assigned to this job. They are not intended to be an exhaustive list of all responsibilities, duties and skills required. The listed or specified responsibilities & duties are considered essential functions for ADA purposes.** **\#LI-AMCBCorporate** **Who We Are:** TD is one of the world's leading global financial institutions and is the fifth largest bank in North America by branches/stores. Every day, we deliver legendary customer experiences to over 27 million households and businesses in Canada, the United States and around the world. More than 95,000 TD colleagues bring their skills, talent, and creativity to the Bank, those we serve, and the economies we support. We are guided by our vision to Be the Better Bank and our purpose to enrich the lives of our customers, communities and colleagues. TD is deeply committed to being a leader in customer experience, that is why we believe that all colleagues, no matter where they work, are customer facing. As we build our business and deliver on our strategy, we are innovating to enhance the customer experience and build capabilities to shape the future of banking. Whether you've got years of banking experience or are just starting your career in financial services, we can help you realize your potential. Through regular leadership and development conversations to mentorship and training programs, we're here to support you towards your goals. As an organization, we keep growing - and so will you. **Our Total Rewards Package** Our Total Rewards package reflects the investments we make in our colleagues to help them and their families achieve their financial, physical and mental well-being goals. Total Rewards at TD includes base salary and variable compensation/incentive awards (e.g., eligibility for cash and/or equity incentive awards, generally through participation in an incentive plan) and several other key plans such as health and well-being benefits, savings and retirement programs, paid time off (including Vacation PTO, Flex PTO, and Holiday PTO), banking benefits and discounts, career development, and reward and recognition. Learn more (*************************************** **Additional Information:** We're delighted that you're considering building a career with TD. Through regular development conversations, training programs, and a competitive benefits plan, we're committed to providing the support our colleagues need to thrive both at work and at home. **Colleague Development** If you're interested in a specific career path or are looking to build certain skills, we want to help you succeed. You'll have regular career, development, and performance conversations with your manager, as well as access to an online learning platform and a variety of mentoring programs to help you unlock future opportunities. Whether you have a passion for helping customers and want to expand your experience, or you want to coach and inspire your colleagues, there are many different career paths within our organization at TD - and we're committed to helping you identify opportunities that support your goals. **Training & Onboarding** We will provide training and onboarding sessions to ensure that you've got everything you need to succeed in your new role. **Interview Process** We'll reach out to candidates of interest to schedule an interview. We do our best to communicate outcomes to all applicants by email or phone call. **Accommodation** TD Bank is an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, age, disability, status as a protected veteran or any other characteristic protected under applicable federal, state, or local law. If you are an applicant with a disability and need accommodations to complete the application process, please email TD Bank US Workplace Accommodations Program at *************** . Include your full name, best way to reach you and the accommodation needed to assist you with the applicant process. Federal law prohibits job discrimination based on race, color, sex, sexual orientation, gender identity, national origin, religion, age, equal pay, disability and genetic information.