Business advisor jobs in Upper Darby, PA - 428 jobs

Häfele America Co. at a quick glance: We are the largest subsidiary of a privately-held, a global powerhouse in the areas of LED lighting, cabinet and furniture hardware, kitchen organization and much more. We offer a strong benefits package including medical, dental, 401(k) with company match, employee discount and other perks. There's a very good reason 41% of our employees have been with us for over ten years - we hire the best, treat people well and truly provide a family atmosphere that works hard and plays to win. KEY RESPONSIBILITIES include the following. Other duties may be assigned. Defined territory consists of kitchen manufacturers and dealers in Eastern, PA. (Role is based is based in PA) Grow and manage sales within assigned accounts, developing strong relationships across Purchasing, Operations, Marketing, and Leadership. Identify and pursue new business with underdeveloped kitchen manufacturers. Promote Hafele's full product offering, including functional hardware, kitchen organization, fasteners, and lighting. Collaborate with internal teams and dealer networks to ensure aligned efforts and maximize sales opportunities. Communicate regularly with Hafele colleagues on dealer feedback, product needs, and market trends. Present new product launches and act as knowledgeable resource on Hafele's solutions. Participate in team strategy sessions and contribute ideas for growth and improvement. Assist in developing "customer specific products" What We're Looking for: A professional, proactive team player with strong relationship-building and communication skills. Someone who thrives in a collaborative, solution-oriented environment. A representative of Hafele who acts with integrity and understands the value we bring to the kitchen and bath industry. EDUCATION and/or EXPERIENCE Bachelor's degree from four-year College or University. Considerations will be made for additional training programs or equivalent combination of education and experience. This individual must have a degree of applicable market and product knowledge. Position requires high degree of comfort in dealing with various level of decision-makers. COMPUTER SKILLS Proficiency in MS Excel, Outlook, PowerPoint and Word. Experience with Salesforce is a plus.

Gateway Search has an exciting Business Developer opportunity with a dynamic and growing regional consulting firm that delivers high -impact advisory services to middle -market companies across a range of industries. The firm specializes in strategic, financial, and operational consulting-and is known for building lasting client relationships and driving measurable growth. As they continue to expand, they're looking for a results -driven Business Developer to help lead their growth efforts by identifying new client opportunities, cultivating relationships with C -level decision -makers, and effectively positioning the firm's service offerings. Key Highlights of the Role: Lead strategic outreach and relationship -building with prospective and existing clients Develop and execute a sales plan aligned with growth goals Collaborate with consulting teams to create tailored solutions Represent the firm at industry events and networking functions Leverage CRM tools to manage the sales pipeline and provide insights to leadership RequirementsWhat They're Looking For: 5+ years of experience in business development or consultative B2B sales (professional services preferred) Proven track record working with middle -market clients Strong communication, negotiation, and strategic thinking skills Comfortable working independently and cross -functionally Bachelor's degree required; MBA preferred Benefits Vision, Dental, Medical, Flexible Time Off, 401K Experience Level Mid -Level (5-8 yrs) Base Salary: $85,000-$110,000 Bonus/Commission: $20,000-$40,000 Total Compensation: $105,000-$150,000 Senior (8-12 yrs) Base Salary: $110,000-$140,000 Bonus/Commission $30,000-$60,000 Total Compensation: $140,000-$200,000+

. Must be willing to travel, with overnight hotel stays, up to 5 nights per week (every week). Reynolds and Reynolds is looking for experienced automotive professionals to join our consulting team. Our superior software solutions, our award-winning sales, service, and support have made us one of the most recognized and respected companies in the automotive industry. As an Automotive Business Consultant your primary focus will be to establish professional relationships with customers and help their businesses become more efficient, effective, and profitable. You will work with dealership personnel to identify trouble areas within the dealership and then use established and proven consulting services programs, as well as your industry knowledge, to help solve these issues. Once a project is complete, you will follow-up with customers to maintain relationships and provide ongoing 'fee for service' support and problem resolution. By helping these customers become successful in the different areas of the dealership, you will build trust that will further drive consulting services sales. If you are looking for an opportunity to utilize your automotive skills and make a difference for automotive dealerships across the country, please apply today!","job_category":"Consulting","job_state":"PA","job_title":"Automotive Business Consultant - Accounting Specialist","date":"2026-01-04","zip":"19019","position_type":"Full-Time","salary_max":"80,000. 00","salary_min":"60,000. 00","requirements":"High School Diploma or equivalent; Bachelor's preferred but not required~^~5+ years of automotive dealership experience (Office Manager, controller(automotive accounting), and AP\/AR Accounting Representative)~^~Must be willing to travel extensively with overnight hotel stays up to 5 nights per week (every week). ~^~Must have reliable transportation as well as a valid driver's license, with fewer than 2 moving violations in the last three years and no OVI\/DUI\/DWI violations in the last five years. ~^~Must have reliable home internet with sufficient bandwidth for video conferencing~^~Experience with Reynolds and Reynolds accounting software is highly preferred","training":"Our training consists of time with experienced consulting and sales representatives in the field for approximately 90 days, online courses completed in your home office, and classroom instruction through our offices in Dayton and Houston. Your compensation during training will be a $60,000-63,000 base salary. You will be eligible for quarterly bonuses after the 9 month training period. Total targeted income after training (including base and bonuses) is $80,000+. ","benefits":"We strive to offer an environment that provides our associates with the right balance between work and family. We offer a comprehensive benefits package including: - Medical, dental, vision, life insurance, and a health savings account - 401(k) with up to 6% matching - Paid vacation and sick days - Eight paid holidays - Referral bonuses - Professional development and training - Promotion from within Reynolds and Reynolds promotes a healthy lifestyle by providing a non-smoking environment. Reynolds and Reynolds is an equal opportunity employer. ","

Job details Salary$25 - $75 an hour ( Based in experience) Job TypePart-time/ Full-time ContractQualifications Master's (Preferred) Business development: 5 years (Preferred) Sales: 5 years (Preferred) Benefits ( Discussed) Full Job Description About the Position Currently seeking a motivated and ambitious who is passionate about creating personable experiences and life-long memories. Responsibilities Hires, trains, supervises, develops, and terminates the employment of those supervised in accordance with company polices and directives Performs timely performance evaluations on Associates. Compiles comprehensive reports regarding performance of Associates. Responsible for implementation of all laws, regulations and policies regarding, employment practices, safety rules and all other company policies and procedures Oversee day-to-day center operations run smoothly and efficiently through a visible management presence and leadership. Process, review and submit payroll for all Spa staff Manage retail and supply inventory through monthly audits and loss control measures, and ensuring all supplies are adequately stocked Daily walk-throughs of center to ensure staff is maintaining a clean, organized and safe facility Manage financial performance of the center through achievement of sales and revenue targets, expense management, proper planning and forecasting, and retention Track, report and analyze the details of financial operation Prepare and implement action plans to meet or exceed monthly financial goals Assist club management in development of annual operating and capital budgets, as well as long term growth strategy Review applicable financial statements and reports Effectively and professionally interacts and communicates with senior management, managers, other Associates, vendors, members, senior staff, and guests. Promote harmonious relations among members, staff, vendors, and the community at-large. Communicate timely and follow up, as appropriate. Active participation in required events, required programs, required meetings and required trainings. Promote the company's safety goals and actively work towards ensuring a safe working environment. Interpret and ensure compliance with company policies and procedures. Actively further Spa objectives and continuously support improvement and positive change, which includes participating on corporate designated committees to improve the company and business operations. Make professional development a consistent priority. Act as club and/or regional Manager on Duty, as required Qualifications Minimum of 5 years prior spa management experience Demonstrated ability to support and develop diverse environment At least 2 years experience in personnel supervision, training, and evaluation Flexibility in work schedule, as job may require day and evening shifts, weekends and holidays Physical Requirements This position deals with outside personnel such as members and clients on a regular basis with contact in various forms such as in person, phone and email. The location of the position changes frequently from indoors to outdoors as site visits are necessary. However, extreme environmental conditions do not exist. It is sometimes necessary to deal with unpleasant or angry people with the need to problem solve difficult situations. It is necessary to adapt to a frequently changing environment. Sitting and standing is as needed. It is necessary for the position to travel independently to property locations on a regular basis. Lift, push and pull up to 30 lbs. Job Types: Part-time, Contract Pay: $25.00 - $75.00 per hour Schedule: 8 hour shift Ability to commute/relocate: South Hampton Pa, 18966: Reliably commute or planning to relocate before starting work (Preferred) Education: Master's (Preferred) Experience: Business development: 5 years (Preferred) Sales: 5 years (Preferred) Willingness to travel: 25% (Preferred) Work Location: One location Hiring Insights Hiring 1 candidate for this role Compensation: $25.00 - $75.00 per hour

ITC WORLDWIDE is seeking a dynamic and experienced Microsoft Business Applications Senior Sales Consultant WFH or an ITC field office Are you passionate about selling business applications solutions that empower organizations to achieve more? Do you have a proven track record of delivering results in a complex and competitive market? Do you have experience with Microsoft Dynamics 365 Finance & Operations or other ERP systems? If so, we want to hear from you. To be successful in this position you will possess the following attributes: Motivated and proactive professional with previous experience in end-to-end sales within Microsoft or equivalent Enterprise Applications. 5+ years face-to-face selling experience - Microsoft product suite expertise including D365, PowerApps and Business Central is highly regarded. Demonstrated ability to hunt new business opportunities. Ability to build and foster strong customer relationships in existing customer base. A strong customer-centric approach and ability to network across a complex organization. Skills in managing multiple commercial processes (new business sales), forecasting precisely and identifying challenges to positive commercial outcomes. Develop and execute a sales strategy in designated territories and work with both vendor and Industry teams to execute. Arrange and conduct customer meetings, serve as trusted advisor by understanding a customer's existing and future digital transformation roadmap and driving the sales. Strong networking skills and industry experience Ability to drive new business and get engaged with lead generation. Liaising with solution consultants to drive correct business outcomes. Desire to be involved in a rapidly growing business and take a leadership role in helping it thrive. Strong personality motivated by continual improvement and self-development Responsibilities: Develop and execute sales strategies to grow revenue and market share in the Finance & Operations segment. Build and maintain strong relationships with key decision makers and influencers across various industries and geographies. Understand customer needs and pain points and propose value-added solutions that leverage Microsoft's D365 platforms and applications. Collaborate with delivery and pre-sales teams to ensure proposed solutions align with client requirements. Working with Marketing and Business Development personnel to help develop lead generation campaigns along with target marketing to specific verticals. · Manage the entire sales cycle, including prospecting, negotiations, and contracting Develop and nurture a robust pipeline of prospects to achieve and exceed sales targets Leverage your sales knowledge and existing Microsoft ecosystem network Qualifications: Minimum of 5 years of experience in selling enterprise software solutions, preferably in the ERP domain Strong knowledge of Microsoft Dynamics 365 Finance & Operations or other ERP systems and their business benefits Excellent communication, presentation, and negotiation skills Ability to work independently and as part of a team in a fast-paced and dynamic environment. Bachelor's degree in business, finance, or related field Prior consulting services sales experience required, and an understanding of Microsoft's Business Applications preferred (Sales, Service, Marketing, Finance, HR, Supply Chain, and Project Operations) Package Details Contract W2 role for an experienced Tech Seller! Base Salary (Draw) W2 Commissioned: from 1-3% on lifetime Support + Bonus on Managed Services +Cash Bonus What's in it for you Qualified Leads Technical Sales & Service Support Product Selling Training Provided Dynamics 365 - CRM Dynamics 365 - Business Central Microsoft 365 ISV Solutions (Offers) Neural Impact Sales Optimization Training Differentiation & Engagement Effective Discovery & CIO Engagement Project Impact & Objection Handling $ 150,000.00 (US Dollar) BIzzApp Sales 2. Acct exec 3. services & support consult

Hours: 40 Pay Details: $86,840 - $139,360 USD TD is committed to providing fair and equitable compensation opportunities to all colleagues. Growth opportunities and skill development are defining features of the colleague experience at TD. Our compensation policies and practices have been designed to allow colleagues to progress through the salary range over time as they progress in their role. The base pay actually offered may vary based upon the candidate's skills and experience, job-related knowledge, geographic location, and other specific business and organizational needs. As a candidate, you are encouraged to ask compensation related questions and have an open dialogue with your recruiter who can provide you more specific details for this role. Line of Business: Business Management, Strategy & Support Job Description: The Control Remediation Quality Assurance Business Management Specialist will have appropriate Audit or Risk and Controls subject matter expertise to assist each Remediation owner through the end-to-end Remediation lifecycle. This role is an integral part of the Review & Challenge tollgate panels at both the workstream and full concern level, ensuring effective remediation, leading to successful Internal Audit validation. This role engages with stakeholders to provide ongoing support as well as receive feedback on R&C coordinator team efforts to identify opportunities to enhance the end-to-end remediation program. Depth & Scope: Works autonomously and accountable for acting as a lead within a specialized business management function and may provide work direction to others Provides seasoned specialized knowledge, advice and/or guidance to various stakeholders and team members Scopes of role may have enterprise impact Focuses on short to medium - term issues (e.g. 6-12 months) Undertakes and completes a variety of complex projects and initiatives requiring specialist knowledge and/or the integration of cross functional processes within own area of expertise Oversees and/or independently performs tasks from end to end Education & Experience: Undergraduate degree 7+ years relevant experience Preferred Qualifications: 7+ years of Audit/Risk and Controls experience is preferred Subject matter expertise within the banking industry Highly organized, with demonstrated ability to develop, analyze, improve and apply complex policies, processes and procedures Solid understanding of Regulatory environment and its role in the banking industry Effective negotiation and influencing skills Advanced communication and presentation skills Works independently as an individual contributor to provide end-to-end support for remediation; including feedback on control of environment Works with all lines of defense on remediation efforts Customer Accountabilities: Contributes to the strategic direction of the business management function and play a key role in the development and implementation of strategies in support of the overall business strategy Plans, leads / manages and/or oversees a diverse set of work activities requiring alignment across multiple areas Leads / manages the integrated implementation of policies / processes / procedures / changes in across multiple functional areas Provides direction and/or input to complex, wide ranging enterprise or cross-function / business projects/initiatives as a subject matter expert and where necessary participates in identifying, designing and testing solutions and supporting the implementation Facilitates key discussions and provides thought leadership to executive audience (output is roadmap and/or strategic plan/ deliverables/frameworks/ short to long term goals etc.) Leads partner to management / leadership and respective teams for area of specialization with industry, external and internal, enterprise and business awareness; recognizing and anticipating emerging trends and; identifying issues and opportunities and recommending action to senior management Works effectively with multiple teams across a broad spectrum of initiatives and functional domains, influencing others as needed Shareholder Accountabilities: Adheres to enterprise frameworks and methodologies that relate to business management activities for own area Actively manages relationships with corporate and/or control functions and ensure alignment with enterprise and/or regulatory requirements Keeps abreast of emerging issues, trends, and evolving regulatory requirements and assess potential impacts to the Bank Assesses / identifies key issues and escalate to appropriate levels and relevant stakeholders where required Maintains a culture of risk management and control, supported by effective processes and sound infrastructure an in alignment with risk appetite Ensures business operations are in compliance with applicable internal and external requirements (e.g. financial controls, segregation of duties, transaction approvals, and physical control of assets). Participates in cross-functional / enterprise initiatives as a subject matter expert helping to identify risk / provide guidance for complex situations Leads relevant governance meetings or committees and related deliverables / outcomes Leads / facilitates and/or implements action/remediation plans to address performance/risk/governance issues Employee/Team Accountabilities: Provides thought leadership and/or industry knowledge for own area of expertise Supports a positive work environment that promotes service to the business, quality, innovation and teamwork and ensure timely communication of issues/ points of interest Identifies and recommends opportunities to enhance productivity, effectiveness and operational efficiency Works effectively as a team, supporting other members of the team in achieving business objectives and providing client services Participates in knowledge transfer within the team and business units Who We Are: TD is one of the world's leading global financial institutions and is the fifth largest bank in North America by branches/stores. Every day, we deliver legendary customer experiences to over 27 million households and businesses in Canada, the United States and around the world. More than 95,000 TD colleagues bring their skills, talent, and creativity to the Bank, those we serve, and the economies we support. We are guided by our vision to Be the Better Bank and our purpose to enrich the lives of our customers, communities and colleagues. TD is deeply committed to being a leader in customer experience, that is why we believe that all colleagues, no matter where they work, are customer facing. As we build our business and deliver on our strategy, we are innovating to enhance the customer experience and build capabilities to shape the future of banking. Whether you've got years of banking experience or are just starting your career in financial services, we can help you realize your potential. Through regular leadership and development conversations to mentorship and training programs, we're here to support you towards your goals. As an organization, we keep growing - and so will you. Our Total Rewards Package Our Total Rewards package reflects the investments we make in our colleagues to help them and their families achieve their financial, physical and mental well-being goals. Total Rewards at TD includes base salary and variable compensation/incentive awards (e.g., eligibility for cash and/or equity incentive awards, generally through participation in an incentive plan) and several other key plans such as health and well-being benefits, savings and retirement programs, paid time off (including Vacation PTO, Flex PTO, and Holiday PTO), banking benefits and discounts, career development, and reward and recognition. Learn more Additional Information: We're delighted that you're considering building a career with TD. Through regular development conversations, training programs, and a competitive benefits plan, we're committed to providing the support our colleagues need to thrive both at work and at home. Colleague Development If you're interested in a specific career path or are looking to build certain skills, we want to help you succeed. You'll have regular career, development, and performance conversations with your manager, as well as access to an online learning platform and a variety of mentoring programs to help you unlock future opportunities. Whether you have a passion for helping customers and want to expand your experience, or you want to coach and inspire your colleagues, there are many different career paths within our organization at TD - and we're committed to helping you identify opportunities that support your goals. Training & Onboarding We will provide training and onboarding sessions to ensure that you've got everything you need to succeed in your new role. Interview Process We'll reach out to candidates of interest to schedule an interview. We do our best to communicate outcomes to all applicants by email or phone call. Accommodation TD Bank is an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, age, disability, status as a protected veteran or any other characteristic protected under applicable federal, state, or local law. If you are an applicant with a disability and need accommodations to complete the application process, please email TD Bank US Workplace Accommodations Program at ***************. Include your full name, best way to reach you and the accommodation needed to assist you with the applicant process.

**The Best Teams are Created and Maintained Here.** + The Business Developer (BD) works to improve BrightView's market position and achieve profitable financial growth. This role helps to achieve long-term organizational strategic goals, builds key customer relationships, identifies business opportunities, negotiates, and closes business deals and maintains extensive knowledge of current market conditions. The Business Developer manages the sales pipeline from prospecting to closing and is responsible for full cycle landscape and, depending on region, snow sales. The Business Developer collaborates and works with partners including operations, finance, marketing, and more to manage responses to bids in an effort to meet sales targets. **Duties and Responsibilities:** + Work with prospective customers to discover their "points of pain" and develop solutions. + Accurately forecast sales deliverables and KPI's + Achieve sales goals and be able to work independently + Perform sales prospecting using consultative sales techniques to build long-standing business relationships; marketing; pricing + Prepare and conduct heavy phone prospecting, sales presentations, virtual demonstrations, and handle contract negotiations with minimum supervision + Identify customer needs and utilize solution-based selling techniques to fully demonstrate value of BrightView services + Cultivate and maintain relationships with prospects and existing clients + Build and maintain trust-based professional relationships with key decision makers + Plan daily and hit specific activity benchmarks and close business + Log activity consistently and reliably in CRM (Salesforce) + Work in a fast-paced environment while operating with a high sense of urgency + Communicate proactively with all decision makers and influencers **Education and Experience:** + Bachelor's Degree or equivalent work experience + Extensive face-to-face (B2B) selling experience at the mid-to-senior levels, 3-5 years of experience + Experience managing multiple projects and able to multi-task in a large territory + Proficient with computer programs including MS Word, Excel, Outlook, and PowerPoint + Experience with a CRM or SFA tool + Proven track record of sales goal attainment and pipeline management + Highly competitive, positive, and results driven + Excellent presentation skills + Excellent oral and written communication skills to build client-centric and solution/value-based proposals + Working experience with social media + Local knowledge and contacts in one or more market segments preferred + Ability to be self-motivated and self-directed + Experience in the service industry with commercial contract sales desirable **Physical Demands/Requirements:** + Constant operation of a computer and other office equipment such as a laptop, cell phone and sales programs/tools + Position is a combination of mobile and sedentary work; must be able to remain in a stationary position for extended periods of time + Customarily and regularly spends more than half of the time working away from BrightView's places of business selling and obtaining orders or contracts for BrightView's services. + Ability to travel by car, train, and plane + Position needs to be able to traverse uneven grounds and walk on jobsites with clients and branch teams for periods of time up to 4 hours **Work Environment:** + Works both indoors and outdoors + Field based position, combination of office and customer facing. **_BrightView Landscapes, LLC is an Equal Opportunity and E-Verify Employer._** **_This job description is subject to change at any time._** **_BrightView offers a suite or health, wellness, and financial benefits to full-time team members. Benefits offerings for full-time team members include medical, dental, and vision insurance, ancillary and voluntary products, a 401k savings plan with employer contributions, and 6 to 9 company paid holidays per year. Employees may also be eligible to receive paid time off for vacation and/or sick leave, tuition reimbursement, and/or potential variable pay opportunities based on position and performance. A detailed benefits package will be provided during the interview process_** _._ _It's Not Just a Team. It's One BrightView._

Our client, a growing, privately owned, Light Industrial Staffing services, in New jersey is looking for a Business Development professional to join their team. This role will focus on bringing in new Light Industrial business in the Southern, NJ, Philly, and Northern Delaware market. Most of this position is field based and Friday's are spent in their Southern New Jersey office Responsibilities include; Prospecting new business by phone, email, social media, and in-person Meeting new clients within an assigned territory (with no internal competition) nts. Using Salesforce to document sales activity, meetings, follow ups etc. Contract negotiations. Reach agreed upon monthly sales targets. YOU might be the right person if YOU have: Previous light industrial temporary staffing sales experience or recruiting experience. Outside B2B sales experience selling into the light industrial space Strong closing abilities. Strong sense or urgency Attention to detail. Our client offers a competitive base salary, commission, car allowance, phone and benefits Master Search Solutions is a direct hire recruiting firm that specializes in the New Jersey marketplace. We have nearly 30 years of experience connecting top talent with leading businesses. We are committed to (and celebrate) diversity, equity, and inclusion.

Job DescriptionBusiness Development - Commercial HVAC (Union Market) Company: Quaker Mechanical Employment Type: Independent Contractor (1099) - Commission OnlyAbout Us Quaker Mechanical is a leading commercial HVAC contractor specializing in union projects. With a reputation for excellence, we deliver top-tier mechanical solutions in the union HVAC marketplace across the Cinnaminson area and beyond. Position Overview We're seeking a driven Business Development professional with a solid background in commercial construction sales within the union HVAC market. This is a 1099, commission- only opportunity designed for self-starting individuals eager to grow their income based on performance. Key Responsibilities Cultivate and maintain relationships with general contractors, developers, and union contacts. Identify and pursue new project opportunities in commercial HVAC. Negotiate and close deals aligned with company capacity and goals. Collaborate with internal teams (estimating, operations) to transition new projects smoothly. Provide market insights and strategic growth recommendations. Qualifications 2+ years of experience in commercial construction sales, with a focus on union HVAC. Familiarity with the union HVAC landscape and strong industry contacts. Excellent negotiation, communication, and relationship-building skills. Ability to work independently in a commission-based, 1099 role. Compensation Structure (Commission + Stipends) This role offers uncapped earning potential through a tiered commission on gross profit, plus fixed monthly stipends: 0.5% on $0 - $100,000 Contract amount 1.0% on $101,000 - $500,000 Contract amount 1.5% on $501,000 - $750,000 Contract amount 2.0% on $751,000 and above Contract amount $100/month cell phone stipend $300/month auto stipend

Job DescriptionBenefits: 401(k) Competitive salary Dental insurance Health insurance Opportunity for advancement Paid time off About Us NIRA Dynamics is a global leader in road-condition analytics using standard vehicles as sensors. Our technology is used by road authorities, automotive OEMs, telematics partners, and infrastructure operators across Europe and North America. With the rapidly growing U.S. market, we are expanding our team to support a new wave of customers and cutting-edge product development. Position Overview We are seeking a Solution Architect with a strong background in civil engineering, pavement technology, and data-driven road management. This role sits at the intersection of sales, development, and customer success, ensuring U.S. customers receive frictionless onboarding, powerful insights, and continuous product value. You will help shape how our products evolve in the U.S. markettranslating customer needs into actionable development tasks, analyzing and delivering data, and supporting both internal teams and external partners. Key Responsibilities Work closely with the both the Sales and the Development teams to support all U.S. customer-facing operations. Lead onboarding for new U.S. customers and provide technical guidance through implementation. Gather customer requirements and communicate them clearly to the development team. Deliver data packages, insights, and visualizations that support customer use cases. Attend meetings, demos, and industry conferences as the technical representative. Analyze existing and incoming datasets to enhance or design new service offerings. Design, plan, and develop new services in collaboration with Product & Development. Support customer integrations and contribute to documentation and best practices. Continuously improve and maintain existing services. Career Path Opportunities You may grow toward: 1. Technical Expert Path Become a high-level translator between customers and developers turning real-world road problems into technical specifications and product improvements. 2. Customer-Facing Path Expand into a hybrid role combining Solution Architecture, Sales Support, and Customer Success, becoming a trusted advisor for DOTs, agencies, and automotive partners. Required Qualifications Education Bachelors degree in Civil Engineering or a related discipline. Work Experience 5+ years in road management, pavement technology, or an equivalent field. Experience with data analysis, data mining, and interpreting road/vehicle sensor datasets. Knowledge & Skills Sales, CRM, or customer-facing technical experience. Basic Python and SQL skills. Expert knowledge of pavement technology and road condition monitoring. Experience with road monitoring or pavement equipment/systems. Fluent in English. Preferred Qualifications Doctorate related to civil engineering. Experience working for a DOT, federal agency, or road management technology company. Publications (articles, white papers, research). Agile development experience. Skills in Java, CI/CD, React with Typescript. Project management experience. Product development experience. Personal Attributes Curious and investigative mindset Passion for pavement and infrastructure innovation Strong initiative and independence Excellent communication and collaboration skills Business-minded and customer-oriented Adaptive and problem-solving oriented Socially competent and receptive to feedback Works effectively in small, fast-moving teams

CORE is currently seeking a hardworking and experienced Title Insurance Sales Representative. Join one of South Jersey's fastest growing title companies and most successful title team! Whether you have a well-established client base or need help taking your business to the next level, we want to meet. Increase overall resale and refinance market share in the New Jersey and Pennsylvania market by building strong relationships with REALTORS, mortgage brokers and loan originators, banks, credit unions. Team player who acts as the liaison between the inside office staff and clients in the field. Must be confident in making cold calls, prospecting for leads, as well as maintaining current customer's needs. Strong social media presence is a plus. Develop and initiate new sales and marketing ideas. Actively pursue office presentations with office brokers and staff Knowledge of real estate business is extremely helpful. Consistently increase business and revenues Candidate must possess the following: Strong work ethic. Must provide own reliable transportation. Superior time management skills OTHER REQUIREMENTS: Attending outside functions both during the day and some evenings Excellent interpersonal communication skills (both written and verbal) Ability to effectively present information one-on-one and in group settings Maintain a professional appearance and providing a positive company image EDUCATION: Minimum High School or equivalent (required) Degree in Sales and Marketing (preferred) EXPERIENCE: 2-5 years of successful sales experience in the Real Estate industry Salary is commensurate with experience Job Type: Full-time

Job DescriptionSalary: Gras Lawn, a commercial landscape company, is seeking an experienced Landscape Business Developer for the South Jersey Market. Your main responsibility is developing business with potential new customers, building and maintaining trusted relationships with key decision-makers, understanding their challenges, and creating value solutions. Your role also involves effectively identifying opportunities, gathering valuable intelligence, creating customer-centric proposals, collaborating with team members, meeting specific activity targets, and closing deals. The Business Developer focuses on strengthening Gras Lawns market presence and driving profitable growth. This position plays a key role in meeting long-term strategic objectives by fostering important customer relationships, identifying business opportunities, negotiating and closing deals, and maintaining a comprehensive understanding of the current market landscape. Identifyandunderstandthechallengesofprospectiveclientsanddevelopsolutions. Provideaccurateforecastsforsales,deliverables,andkeyperformanceindicators(KPIs). Achievesalesgoalswhilehavingtheabilitytoworkindependently. Usesalestechniquestofindnewcustomersandbuildlong-termbusinessrelationships.Also,focusonmarketingandpricingstrategies. Conductphoneprospecting,salespresentations,virtualdemonstrations,andcontractnegotiationswithminimalsupervision. Identifycustomerneedsandapplysolution-basedsellingtechniquestodemonstratethevalueof GrasLawnsserviceseffectively. Buildandnurturerelationshipswithpotentialandcurrentclients. Planyourdailyactivitiesandaimtomeetspecificperformancebenchmarkstoclosebusinessdealssuccessfully. ConsistentlyandreliablylogactivitiesintheCRM. Workeffectivelyinafast-pacedenvironmentwhilemaintainingastrongsenseofurgency. Communicateproactivelywithallclients,prospects,andcolleagues. SkillsRequired: ExtensiveexperienceintheCommercialLandscapeIndustry Proventrackrecordofsalesgoalattainmentandpipelinemanagement 3-5yearsofexperienceinB2Bsalesatmid-to-seniorlevels. Localknowledgeandcontactsinoneormoremarketsegments Proficientwithcomputerprograms,including AspireandaCRMtool Highlycompetitive,positive,andresults-driven Exceptionalmultitasker. Excellentoralandwrittencommunicationabilities,strongpresentationskills,andprofessionalexperiencewithsocialmedia. Passionate,organized,andresourcefulindividualwithoutstandinglisteningandinterpersonalskills. Highly organized, self-motivated, and hardworking, with effective time management capabilities. Easilyadaptabletonewsituations. Salary commensurate with experience. Youwillberesponsiblefor: TheBusinessDeveloperoverseesthesalespipelinefromtheprospectingstagetoclosingandisaccountablefortheentiresalescycle,includingsnowsalesincertainregions.Additionally,the BusinessDeveloperworksincollaborationwithpartnersacrossoperations,finance,marketing,andotherdepartmentstoeffectivelyrespondtobidsandachievesalesgoals. Salary commensurate with experience.

Mount Laurel, New Jersey, United States of America **Hours:** 40 **Pay Details:** $92,220 - $149,310 USD TD is committed to providing fair and equitable compensation opportunities to all colleagues. Growth opportunities and skill development are defining features of the colleague experience at TD. Our compensation policies and practices have been designed to allow colleagues to progress through the salary range over time as they progress in their role. The base pay actually offered may vary based upon the candidate's skills and experience, job-related knowledge, geographic location, and other specific business and organizational needs. As a candidate, you are encouraged to ask compensation related questions and have an open dialogue with your recruiter who can provide you more specific details for this role. **Line of Business:** Analytics, Insights, & Artificial Intelligence **:** The Business Insights Specialist is responsible for conducting analyses on curated and/or aggregated DataMart's in conjunction with deep business subject matter expertise, to generate relevant analytical insights for business issues and identify opportunities to drive business growth and value. This role works in partnership with business leaders to present or generate appropriate insights including the delivery of supporting collateral and/or presentations. Job Description **Depth & Scope:** + Works autonomously and accountable for acting as a lead within a specialized business management function and may provide work direction to others + Provides seasoned specialized knowledge, advice and/or guidance to various stakeholders and team members + Scope of role may have enterprise impact + Focuses on short to medium - term issues (e.g. 6-12 months) + Undertakes and completes a variety of complex projects and initiatives requiring specialist knowledge and/or the integration of cross functional processes within own area of expertise + Oversees and/or independently performs tasks from end-to-end + May interact with any hierarchy level up to executive leaders and external vendors **Education & Experience:** + Undergraduate degree or advanced technical degree preferred (e.g., math, physics, engineering, finance or computer science) Graduate's degree preferred with either progressive project work experience, or; + 5+ year of relevant experience; higher degree education and research tenure can be counted **Preferred Skills:** + Experience with PowerBI or Tableau + Data Analytics & Technology Skills + Ability to prioritize and work in a fast-paced environment + Relevant Audit experience is a plus, but not required **Customer Accountabilities:** + Leads on the interpretation of complex business issues, generates multifaceted insights and identifies opportunities to help drive business growth or address business/enterprise needs + Presents and communicates generated insights and recommended business actions to stakeholders/business leaders in an easily digestible manner, leveraging tools/techniques/methods to produce a variety of visualizations/presentations that fit the audience + Acts as the primary interface with business to bridge and translate business requirements to analytics and reporting needs for a given domain/business + Applies collaborative and strong stakeholder management approach to constructively influence and persuade stakeholders and partners where appropriate + Serves as an authority on a given business domain and provides business expertise to place context around analytics discovery and inform recommendations + Escalates data/process related problems and communicates to relevant teams in a timely manner and makes recommendations for resolution + Provides day-to-day support and delivery of analytics **Shareholder Accountabilities:** + Represents functional area as a business insights & analytics specialized expert + Synthesizes complex and vast amount of information and translates into actionable insights and strategy + Builds business requirements and facilitates project execution to develop insights + Collaborates with partners on business challenges and delivers fact-based analytical advice that aligns to strategy and drives shareholder value + Identifies opportunities for business growth within a specific business or function by identifying potential use cases and value drivers + Utilizes both quantitative and qualitative methodologies to interpret and present data effectively and clearly + Works directly with the business teams to gather the demand for analytics and work with the analytics hub to fulfill the analytics demand + Provides business explanation for anomalies/outliers identified during analysis + Works with business functions and analytics teams to transition business requirements to analytics requirements + Trains business users on how to integrate analytics into decisions + Leverages knowledge of data capabilities to build and deliver insights + Develops analysis to corroborate initial proof of concept + Executes on data requests accurately and within a timely manner + Identifies and investigates data/analytics related issues + Ensures business operations are in compliance with applicable internal and external requirements (e.g. financial controls, segregation of duties, transaction approvals and physical control of assets) + Leads/facilitates and/or implements action/remediation plans to address performance/risk/governance issues + Actively manages relationships within and across various business lines, corporate and/or control functions and ensures alignment with enterprise and/or regulatory requirements + Keeps abreast of emerging issues, trends, and evolving regulatory requirements and assesses potential impacts + Maintains a culture of risk management and control, supported by effective processes in alignment with risk appetite **Employee/Team Accountabilities:** + Participates fully as a member of the team, supports a positive work environment that promotes service to the business, quality, innovation and teamwork and ensures timely communication of issues/points of interest + Provides thought leadership and/or industry knowledge for own area of expertise in own area and participates in knowledge transfer within the team and business unit + Keeps current on emerging trends/developments and grows knowledge of the business, related tools and techniques + Participates in personal performance management and development activities, including cross training within own team + Keeps others informed and up to date about the status/progress of projects and/or all relevant or useful information related to day-to-day activities + Contributes to team development of skills and capabilities through mentorship of others, by sharing knowledge and experiences and leveraging best practices + Leads, motivates and develops relationships with internal and external business partners/stakeholders to develop productive working relationships + Contributes to a fair, positive and equitable environment that supports a diverse workforce + Acts as a brand ambassador for your business area/function and the bank, both internally and/or externally + Contribute to data deliverables including Internal, Senior Management, and Audit Committee Reporting + Apply automation and innovation on data platforms to support business function + Design and implement complex business data information management frameworks to provide a solution that meets business requirements + Understand business data and provide analysis and requirements to ensure the data design / development initiatives are in line with the planned design and standards + Conduct meaningful analysis at the functional or enterprise level using results to draw conclusions, make recommendations, assess the effectiveness of programs/ policies/ practices. + Implement continuous process / performance improvements where opportunities exist. \#LI-AMCBCorporate \#IN-AMCBCorporate **Who We Are:** TD is one of the world's leading global financial institutions and is the fifth largest bank in North America by branches/stores. Every day, we deliver legendary customer experiences to over 27 million households and businesses in Canada, the United States and around the world. More than 95,000 TD colleagues bring their skills, talent, and creativity to the Bank, those we serve, and the economies we support. We are guided by our vision to Be the Better Bank and our purpose to enrich the lives of our customers, communities and colleagues. TD is deeply committed to being a leader in customer experience, that is why we believe that all colleagues, no matter where they work, are customer facing. As we build our business and deliver on our strategy, we are innovating to enhance the customer experience and build capabilities to shape the future of banking. Whether you've got years of banking experience or are just starting your career in financial services, we can help you realize your potential. Through regular leadership and development conversations to mentorship and training programs, we're here to support you towards your goals. As an organization, we keep growing - and so will you. **Our Total Rewards Package** Our Total Rewards package reflects the investments we make in our colleagues to help them and their families achieve their financial, physical and mental well-being goals. Total Rewards at TD includes base salary and variable compensation/incentive awards (e.g., eligibility for cash and/or equity incentive awards, generally through participation in an incentive plan) and several other key plans such as health and well-being benefits, savings and retirement programs, paid time off (including Vacation PTO, Flex PTO, and Holiday PTO), banking benefits and discounts, career development, and reward and recognition. Learn more (*************************************** **Additional Information:** We're delighted that you're considering building a career with TD. Through regular development conversations, training programs, and a competitive benefits plan, we're committed to providing the support our colleagues need to thrive both at work and at home. **Colleague Development** If you're interested in a specific career path or are looking to build certain skills, we want to help you succeed. You'll have regular career, development, and performance conversations with your manager, as well as access to an online learning platform and a variety of mentoring programs to help you unlock future opportunities. Whether you have a passion for helping customers and want to expand your experience, or you want to coach and inspire your colleagues, there are many different career paths within our organization at TD - and we're committed to helping you identify opportunities that support your goals. **Training & Onboarding** We will provide training and onboarding sessions to ensure that you've got everything you need to succeed in your new role. **Interview Process** We'll reach out to candidates of interest to schedule an interview. We do our best to communicate outcomes to all applicants by email or phone call. **Accommodation** TD Bank is an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, age, disability, status as a protected veteran or any other characteristic protected under applicable federal, state, or local law. If you are an applicant with a disability and need accommodations to complete the application process, please email TD Bank US Workplace Accommodations Program at *************** . Include your full name, best way to reach you and the accommodation needed to assist you with the applicant process. Federal law prohibits job discrimination based on race, color, sex, sexual orientation, gender identity, national origin, religion, age, equal pay, disability and genetic information.

Insperity provides the most comprehensive suite of scalable HR solutions available in the marketplace with an optimal blend of premium HR service and technology. With more than 90 locations throughout the U.S., Insperity is currently making a difference for thousands of businesses and communities nationwide. Behind our success is the unshakeable belief in the value of our people. We value diversity, inclusivity and a sense of belonging. We celebrate work and life events, and we partner with our clients and communities to make great things happen. We have received recognition numerous times as a top place to work, most recently ranking on Glassdoor's "Best Places to Work in the U.S. 2024" list, and U.S. News & World Report's "Best Companies to Work for 2024" list. In addition, we have been recognized for having one of the country's Top 50 Midsize Early Talent Programs by RippleMatch's 2024 Campus Forward Awards. There is no better time to be a part of Insperity, and our best work is yet to come. Learn more at Insperity.com. Why Insperity? Flexibility: Over 80% of Insperity's jobs have flexibility. We want your time to have balance, whether it's spent with coworkers, clients, family or your community. Career Growth: Insperity provides many ways to grow with the company. We offer continuous learning programs, mentorship opportunities and ongoing training. Well-Being: Our total rewards package includes generous paid time off, top-tier medical, dental and vision benefits, health & wellness support, paid volunteer hours and much more. We take care of our people so that you can do your best work. SUMMARY This position is responsible for selling Insperity's HRCore to organizations as assigned. RESPONSIBILITIES * Meets minimum acceptable sales and activity levels, as determined by management. * Works closely with assigned BPA office(s) to build and maintain a pipeline that will meet or exceed monthly, quarterly, and yearly sales goals and objectives. * Proactively calls on prospective customers to explain benefits, and value of Insperity's HRCore offering. * Cultivates and closes new HRCore customers in a defined territory. * Follows up on sales leads generated from a variety of sources. * Serves as a key stakeholder in pipeline management and client relations and ensures sales goals are met. * Develops and manages relationships with prospects and customers to ensure customer satisfaction and a strong base for referrals. * Forecasts accurately and maintains all sales cycle activities within the appropriate systems in accordance with the Company's sales process and methodology. * Educates prospects on the benefits of the Company's products and solutions through compelling articulation of our business model and value proposition. * Continues to develop and enhance business cases for prospective customers that reinforce the market leadership position of Insperity in the marketplace. * Evaluates prospects' business needs and presents appropriate mix of Company's products and solutions. * Works in collaboration with other Insperity sales teams to ensure timely, high-quality prospect decisions for HRCore. * Ability to work in a rapidly changing, team environment. * Ability to work within a multi-disciplinary team of sales, technology, professional services, legal, and finance to close a sale that meets both the financial needs of the customer and the company. * Ability to coordinate and work with extended team members particularly in a matrix company and client scenario. * Strong negotiation skills to successfully handle tough situations with both internal and external groups. Ability to win concessions without damaging relationships. * Ability to meet or exceed personal and team weekly, monthly, quarterly, and annual goals. * Strong working knowledge of technology platforms available to Insperity HRCore customers. * Demonstrated meeting facilitation skills, ability to conduct web conferences and phone-based interactions. QUALIFICATIONS * High School Diploma or equivalent is required. Bachelor's Degree is preferred. * Five years of B2B selling experience is preferred but not required. * Multi-year track record of successfully closing a high number of new customers, in a lead role, is strongly preferred. TRAVEL REQUIREMENTS Travels: Yes, up to 20% of time At Insperity, we celebrate the diversity of our employees and our leadership. Insperity is an equal opportunity employer, and all qualified applicants will receive consideration for employment without regard to race, color, religion, sex, national origin, disability status, protected veteran status or any other characteristic protected by law.

We are a business development and sales company that executes promotional campaigns to drive sales on behalf of our brand partners. Our partners rely on us to increase revenue, generate positive experiences, and raise customer satisfaction ratings. The primary responsibility of the Business Development Associate is to create business and sales opportunities through direct-to-consumer campaigns. They will actively engage and deliver compelling product presentations in an effort to increase revenue and generate sales. Additionally, as the Business Development Associate, you will have the opportunity to take on leadership and managerial responsibilities upon successfully achieving KPIs set by senior management. If you're a passionate self-starter with an interest in business development, growth, and client relations, we look forward to hearing from you! What You'll Do as a Business Development Associate: Prospect potential customers/business opportunities by vetting warm leads Build and maintain relationships with customers, stakeholders, clients, and fellow staff Work closely with the sales and customer service teams to maintain KPIs at high levels Identify areas of improvement and communicate feedback professionally and effectively Monitor sales and customer service pipelines, track progress, and hold regular meetings with appropriate staff Examine profit and loss statements to ensure company funds are utilized appropriately Convert sales leads into valuable long-term customers by utilizing stellar customer service What We're Looking For in a Business Development Associate: A bachelor's degree or equivalent, preferred 1+ years of experience in business development and/or management, preferred Ambitious self-starters with a passion for client relations and business development Critical thinking skills, the ability to come up with creative solutions on your feet A team player who's able to communicate effectively with fellow staff and customers Familiarity with sales, lead generation, customer service, or business development practices is a plus Growth-oriented individuals looking to grow with a company long-term Why Join Us? Travel opportunities- all transportation & accommodation expenses covered! Internal growth opportunities- we only promote from within our company! Comprehensive business development guidance & mentorship Commission bonuses are available with uncapped earning potential Competitive weekly pay

**The Best Teams are Created and Maintained Here.** + The Maintenance Installation Business Developer is responsible for driving new business growth by identifying, pursuing, and securing contracts for small scale landscape construction services and installation projects. This role requires a strong balance of sales expertise, industry knowledge, and relationship management to expand the client base, increase revenue, and ensure long-term customer satisfaction. **Key Responsibilities:** + Generate new business opportunities through prospecting, networking, referrals, and cold outreach + Build and maintain a healthy pipeline of opportunities for installation projects outside the Maintenance book of business. + Develop customized proposals and sales presentations that address client needs and highlight company value + Negotiate and close contracts in alignment with company pricing standards and profitability goals + Build strong, long-term relationships with property managers, developers, general contractors, and decision-makers + Serve as the primary point of contact during the sales cycle and ensure a smooth transition to operations teams post-sale + Conduct regular follow-ups to ensure client satisfaction, identify upsell opportunities, and drive retention + Stay informed on local market conditions, competitor activity, and industry trends to identify new opportunities + Represent the company at trade associations, networking events, and community engagements. + Leverage market intelligence to position the company as a preferred partner for landscaping installation solutions + Partner with estimating, operations, and project management teams to ensure accurate proposals and service delivery. Review large scale ($1M or greater) jobs with senior leadership (SVP) + Work with branch and senior leadership to set annual sales goals, budgets, and strategies + Maintain accurate records of sales activities, pipeline development, and results using CRM systems **Education and Experience:** + Bachelor's degree in business, Horticulture, Landscape Architecture, or related field preferred (or equivalent work experience) + 3-5 years of proven success in B2B sales preferably in landscaping, construction, property management, facility management or related service industries + Knowledge of landscape maintenance and installation practices, horticulture, and project management fundamentals + Strong sales, negotiation, and presentation skills + Self-motivated, results-driven, and comfortable working independently + Proficiency with CRM tools, Microsoft Office Suite, and sales reporting **Physical Demands/Requirements:** + Regular local travel to client sites, industry events, and networking opportunities + Office-based activities including proposal development, client follow-up, and team collaboration + Ability to physically perform the basic life operational functions of walking, standing, and kneeling + Valid driver's license with a clean driving record **Work Environment:** + Works in an indoor office and outdoors during construction site walks or project evaluations + Requires occasional evening and/or weekend networking events or meetings **_BrightView Landscapes, LLC is an Equal Opportunity and E-Verify Employer._** **_This job description is subject to change at any time._** **_BrightView offers a suite or health, wellness, and financial benefits to full-time team members. Benefits offerings for full-time team members include medical, dental, and vision insurance, ancillary and voluntary products, a 401k savings plan with employer contributions, and 6 to 9 company paid holidays per year. Employees may also be eligible to receive paid time off for vacation and/or sick leave, tuition reimbursement, and/or potential variable pay opportunities based on position and performance. A detailed benefits package will be provided during the interview process_** _._ _It's Not Just a Team. It's One BrightView._

Job DescriptionSalary: Gras Lawn, a commercial landscape company, is seeking an experienced Landscape Business Developer for the Philadelphia Market. Your main responsibility is developing business with potential new customers, building and maintaining trusted relationships with key decision-makers, understanding their challenges, and creating value solutions. Your role also involves effectively identifying opportunities, gathering valuable intelligence, creating customer-centric proposals, collaborating with team members, meeting specific activity targets, and closing deals. The Business Developer focuses on strengthening Gras Lawns market presence and driving profitable growth. This position plays a key role in meeting long-term strategic objectives by fostering important customer relationships, identifying business opportunities, negotiating and closing deals, and maintaining a comprehensive understanding of the current market landscape. Identifyandunderstandthechallengesofprospectiveclientsanddevelopsolutions. Provideaccurateforecastsforsales,deliverables,andkeyperformanceindicators(KPIs). Achievesalesgoalswhilehavingtheabilitytoworkindependently. Usesalestechniquestofindnewcustomersandbuildlong-termbusinessrelationships.Also,focusonmarketingandpricingstrategies. Conductphoneprospecting,salespresentations,virtualdemonstrations,andcontractnegotiationswithminimalsupervision. Identifycustomerneedsandapplysolution-basedsellingtechniquestodemonstratethevalueof GrasLawnsserviceseffectively. Buildandnurturerelationshipswithpotentialandcurrentclients. Planyourdailyactivitiesandaimtomeetspecificperformancebenchmarkstoclosebusinessdealssuccessfully. ConsistentlyandreliablylogactivitiesintheCRM. Workeffectivelyinafast-pacedenvironmentwhilemaintainingastrongsenseofurgency. Communicateproactivelywithallclients,prospects,andcolleagues. SkillsRequired: ExtensiveexperienceintheCommercialLandscapeIndustry Proventrackrecordofsalesgoalattainmentandpipelinemanagement 3-5yearsofexperienceinB2Bsalesatmid-to-seniorlevels. Localknowledgeandcontactsinoneormoremarketsegments Proficientwithcomputerprograms,including AspireandaCRMtool Highlycompetitive,positive,andresults-driven Exceptionalmultitasker. Excellentoralandwrittencommunicationabilities,strongpresentationskills,andprofessionalexperiencewithsocialmedia. Passionate,organized,andresourcefulindividualwithoutstandinglisteningandinterpersonalskills. Highly organized, self-motivated, and hardworking, with effective time management capabilities. Easilyadaptabletonewsituations. Salary commensurate with experience. Youwillberesponsiblefor: TheBusinessDeveloperoverseesthesalespipelinefromtheprospectingstagetoclosingandisaccountablefortheentiresalescycle,includingsnowsalesincertainregions.Additionally,the BusinessDeveloperworksincollaborationwithpartnersacrossoperations,finance,marketing,andotherdepartmentstoeffectivelyrespondtobidsandachievesalesgoals. Salary commensurate with experience.

Hours: 40 Pay Details: $122,304 - $199,680 USD TD is committed to providing fair and equitable compensation opportunities to all colleagues. Growth opportunities and skill development are defining features of the colleague experience at TD. Our compensation policies and practices have been designed to allow colleagues to progress through the salary range over time as they progress in their role. The base pay actually offered may vary based upon the candidate's skills and experience, job-related knowledge, geographic location, and other specific business and organizational needs. As a candidate, you are encouraged to ask compensation related questions and have an open dialogue with your recruiter who can provide you more specific details for this role. Line of Business: Analytics, Insights, & Artificial Intelligence Job Description: Department Overview:ORM Lead Business Insights Specialist, Stress Testing & Scenario Analysis will serve as a key resource leading ORM's stress testing and scenario analysis program. This role requires ability to execute advanced quantitative modeling along with managing high-stakes regulatory governance.The Lead Business Insights Specialist acts as an advisor to business leaders and stakeholders. This role provides comprehensive analytical support, interpretation of complex data, BI or analytics outcomes to generate multidimensional insights that drive business growth and value. This role works in partnership with business leaders to present or generate appropriate insights including the delivery of supporting collateral and/or presentations.Depth & Scope: Generally accountable for a significant business or area that has cross business or enterprise-wide impact or accountability Enterprise domain/functional and deep specialized knowledge at the enterprise, business, regulatory and industry levels Undertakes and completes a variety of complex initiatives requiring seasoned specialist knowledge and/or the integration of cross functional processes Typically deals with senior/executive management Focuses on longer-range planning for functional area (e.g. 12 months or greater) May manage and prioritize multiple projects at a given time May interact with any hierarchy level up to executive leaders and external vendors Primary Accountabilities: Regulatory Execution: Lead the end-to-end delivery of the ORM Stress Testing Program, ensuring all regulatory requirements for operational risk losses and capital are met within required timelines. Scope: Manage the execution of: US Regulatory: Dodd-Frank Act Stress Testing (DFAST) and Comprehensive Capital Analysis and Review (CCAR). Canadian Regulatory: OSFI Macro Stress Test (MST). Internal: Annual Enterprise-wide Stress Test (EWST) and ad-hoc requests. Scenario Analysis: Lead the development and implementation of the Scenario Analysis program, ensuring alignment with enterprise standards and regulatory requirements. Methodology & Documentation: Aid in the development and execution of the methodology, procedures, and documentation for operational risk stress testing programs. Collaboration: Partner extensively with key stakeholders to ensure program success, including Model Development and Model Validation, ORM Internal Loss Event Data team, Enterprise Capital Stress Testing, US CCAR Governance team, Finance, Regulators, and External Consultants Advanced Analytics: Utilize Python to handle large datasets and apply modeling techniques such as Loss Distribution Approach (LDA), Regression Modeling, and Scenario Analysis to forecast losses. Process Automation: Design and deploy Power Automate flows to streamline data collection from stakeholders (e.g., Scenario Analysis workshops) and automate approval workflows. Reporting & Visualization: Build and maintain Power BI dashboards to visualize stress test results and scenario impacts for senior management and the US CCAR Governance team. Preferred Qualifications: 5+ years of experience in stress testing (CCAR/DFAST), operational risk modeling, or capital planning. Experience with OSFI (Canada) regulatory requirements is a strong asset, in addition to US Fed requirements. Master's degree in a quantitative discipline (Finance, Statistics, Economics, Data Science). Proficient in data manipulation (Pandas) and statistical modeling. Advanced skills in Power BI (reporting) and Power Automate (workflow optimization). Deep understanding of operational risk capital methodologies (LDA, Monte Carlo, Frequency/Severity modeling). Proven ability to manage regulatory relationships and defend methodologies to Model Validation and Audit. Strong leadership skills to oversee a focused team of professionals. Education & Experience: Undergraduate degree or advanced technical degree preferred (e.g., math, physics, engineering, finance or computer science) Graduate's degree preferred with either progressive project work experience, or; 7+ year of relevant experience; higher degree education and research tenure can be counted Customer Accountabilities: Leads on the interpretation of complex business issues, generates multifaceted insights and identifies opportunities to help drive business growth or address business/enterprise needs Presents and communicates generated insights and recommended business actions to stakeholders/business leaders in an easily digestible manner, leveraging tools/techniques/methods to produce a variety of visualizations/presentations that fit the audience Acts as the primary interface with business to bridge and translate business requirements to analytics and reporting needs for a given domain/business Applies collaborative and strong stakeholder management approach to constructively influence and persuade stakeholders and partners where appropriate Serves as an authority on a given business domain and provides business expertise to place context around analytics discovery and inform recommendations Escalates data/process related problems and communicates to relevant teams in a timely manner and makes recommendations for resolution Provides day-to-day support and delivery of analytics Shareholder Accountabilities: Represents functional area as a business insights & analytics specialized expert Synthesizes complex and vast amount of information and translates into actionable insights and strategy Builds business requirements and facilitates project execution to develop insights Collaborates with partners on business challenges and delivers fact-based analytical advice that aligns to strategy and drives shareholder value Identifies opportunities for business growth within a specific business or function by identifying potential use cases and value drivers Utilizes both quantitative and qualitative methodologies to interpret and present data effectively and clearly Works directly with the business teams to gather the demand for analytics and work with the analytics hub to fulfill the analytics demand Provides business explanation for anomalies/outliers identified during analysis Works with business functions and analytics teams to transition business requirements to analytics requirements Trains business users on how to integrate analytics into decisions Leverages knowledge of data capabilities to build and deliver insights Develops analysis to corroborate initial proof of concept Executes on data requests accurately and within a timely manner Identifies and investigates data/analytics related issues Ensures business operations are in compliance with applicable internal and external requirements (e.g. financial controls, segregation of duties, transaction approvals and physical control of assets) Leads/facilitates and/or implements actions/remediation plans to address performance/risk/governance issues Actively manages relationships within and across various business lines, corporate and/or control functions and ensures alignment with enterprise and/or regulatory requirements Keeps abreast of emerging issues, trends, and evolving regulatory requirements and assesses potential impacts Maintains a culture of risk management and control, supported by effective processes in alignment with risk appetite Employee/Team Accountabilities: Participates fully as a member of the team, supports a positive work environment that promotes service to the business, quality, innovation and teamwork and ensures timely communication of issues/points of interest Provides thought leadership and/or industry knowledge for own area of expertise in own area and participates in knowledge transfer within the team and business unit Keeps current on emerging trends/developments and grows knowledge of the business, related tools and techniques Participates in personal performance management and development activities, including cross training within own team Keeps others informed and up to date about the status/progress of projects and/or all relevant or useful information related to day-to-day activities Contributes to team development of skills and capabilities through mentorship of others, by sharing knowledge and experiences and leveraging best practices Leads, motivates and develops relationships with internal and external business partners/stakeholders to develop productive working relationships Contributes to a fair, positive and equitable environment that supports a diverse workforce Acts as a brand ambassador for your business area/function and the bank, both internally and/or externally Physical Requirements:Never: 0%; Occasional: 1-33%; Frequent: 34-66%; Continuous: 67-100% Domestic Travel - Occasional International Travel - Never Performing sedentary work - Continuous Performing multiple tasks - Continuous Operating standard office equipment - Continuous Responding quickly to sounds - Occasional Sitting - Continuous Standing - Occasional Walking - Occasional Moving safely in confined spaces - Occasional Lifting/Carrying (under 25 lbs.) - Occasional Lifting/Carrying (over 25 lbs.) - Never Squatting - Occasional Bending - Occasional Kneeling - Never Crawling - Never Climbing - Never Reaching overhead - Never Reaching forward - Occasional Pushing - Never Pulling - Never Twisting - Never Concentrating for long periods of time - Continuous Applying common sense to deal with problems involving standardized situations - Continuous Reading, writing and comprehending instructions - Continuous Adding, subtracting, multiplying and dividing - Continuous The above statements are intended to describe the general nature and level of work being performed by people assigned to this job. They are not intended to be an exhaustive list of all responsibilities, duties and skills required. The listed or specified responsibilities & duties are considered essential functions for ADA purposes.#LI-AMCBCorporate Who We Are: TD is one of the world's leading global financial institutions and is the fifth largest bank in North America by branches/stores. Every day, we deliver legendary customer experiences to over 27 million households and businesses in Canada, the United States and around the world. More than 95,000 TD colleagues bring their skills, talent, and creativity to the Bank, those we serve, and the economies we support. We are guided by our vision to Be the Better Bank and our purpose to enrich the lives of our customers, communities and colleagues. TD is deeply committed to being a leader in customer experience, that is why we believe that all colleagues, no matter where they work, are customer facing. As we build our business and deliver on our strategy, we are innovating to enhance the customer experience and build capabilities to shape the future of banking. Whether you've got years of banking experience or are just starting your career in financial services, we can help you realize your potential. Through regular leadership and development conversations to mentorship and training programs, we're here to support you towards your goals. As an organization, we keep growing - and so will you. Our Total Rewards Package Our Total Rewards package reflects the investments we make in our colleagues to help them and their families achieve their financial, physical and mental well-being goals. Total Rewards at TD includes base salary and variable compensation/incentive awards (e.g., eligibility for cash and/or equity incentive awards, generally through participation in an incentive plan) and several other key plans such as health and well-being benefits, savings and retirement programs, paid time off (including Vacation PTO, Flex PTO, and Holiday PTO), banking benefits and discounts, career development, and reward and recognition. Learn more Additional Information: We're delighted that you're considering building a career with TD. Through regular development conversations, training programs, and a competitive benefits plan, we're committed to providing the support our colleagues need to thrive both at work and at home. Colleague Development If you're interested in a specific career path or are looking to build certain skills, we want to help you succeed. You'll have regular career, development, and performance conversations with your manager, as well as access to an online learning platform and a variety of mentoring programs to help you unlock future opportunities. Whether you have a passion for helping customers and want to expand your experience, or you want to coach and inspire your colleagues, there are many different career paths within our organization at TD - and we're committed to helping you identify opportunities that support your goals. Training & Onboarding We will provide training and onboarding sessions to ensure that you've got everything you need to succeed in your new role. Interview Process We'll reach out to candidates of interest to schedule an interview. We do our best to communicate outcomes to all applicants by email or phone call. Accommodation TD Bank is an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, age, disability, status as a protected veteran or any other characteristic protected under applicable federal, state, or local law. If you are an applicant with a disability and need accommodations to complete the application process, please email TD Bank US Workplace Accommodations Program at ***************. Include your full name, best way to reach you and the accommodation needed to assist you with the applicant process.

Mount Laurel, New Jersey, United States of America **Hours:** 40 **Pay Details:** $86,840 - $139,360 USD TD is committed to providing fair and equitable compensation opportunities to all colleagues. Growth opportunities and skill development are defining features of the colleague experience at TD. Our compensation policies and practices have been designed to allow colleagues to progress through the salary range over time as they progress in their role. The base pay actually offered may vary based upon the candidate's skills and experience, job-related knowledge, geographic location, and other specific business and organizational needs. As a candidate, you are encouraged to ask compensation related questions and have an open dialogue with your recruiter who can provide you more specific details for this role. **Line of Business:** Business Management, Strategy & Support **Job Description:** The Control Remediation Quality Assurance Business Management Specialist will have appropriate Audit or Risk and Controls subject matter expertise to assist each Remediation owner through the end-to-end Remediation lifecycle. This role is an integral part of the Review & Challenge tollgate panels at both the workstream and full concern level, ensuring effective remediation, leading to successful Internal Audit validation. This role engages with stakeholders to provide ongoing support as well as receive feedback on R&C coordinator team efforts to identify opportunities to enhance the end-to-end remediation program. **Depth & Scope:** + Works autonomously and accountable for acting as a lead within a specialized business management function and may provide work direction to others + Provides seasoned specialized knowledge, advice and/or guidance to various stakeholders and team members + Scopes of role may have enterprise impact + Focuses on short to medium - term issues (e.g. 6-12 months) + Undertakes and completes a variety of complex projects and initiatives requiring specialist knowledge and/or the integration of cross functional processes within own area of expertise + Oversees and/or independently performs tasks from end to end **Education & Experience:** + Undergraduate degree + 7+ years relevant experience **Preferred Qualifications:** + 7+ years of Audit/Risk and Controls experience is preferred + Subject matter expertise within the banking industry + Highly organized, with demonstrated ability to develop, analyze, improve and apply complex policies, processes and procedures + Solid understanding of Regulatory environment and its role in the banking industry + Effective negotiation and influencing skills + Advanced communication and presentation skills + Works independently as an individual contributor to provide end-to-end support for remediation; including feedback on control of environment + Works with all lines of defense on remediation efforts **Customer Accountabilities:** + Contributes to the strategic direction of the business management function and play a key role in the development and implementation of strategies in support of the overall business strategy + Plans, leads / manages and/or oversees a diverse set of work activities requiring alignment across multiple areas + Leads / manages the integrated implementation of policies / processes / procedures / changes in across multiple functional areas + Provides direction and/or input to complex, wide ranging enterprise or cross-function / business projects/initiatives as a subject matter expert and where necessary participates in identifying, designing and testing solutions and supporting the implementation + Facilitates key discussions and provides thought leadership to executive audience (output is roadmap and/or strategic plan/ deliverables/frameworks/ short to long term goals etc.) + Leads partner to management / leadership and respective teams for area of specialization with industry, external and internal, enterprise and business awareness; recognizing and anticipating emerging trends and; identifying issues and opportunities and recommending action to senior management + Works effectively with multiple teams across a broad spectrum of initiatives and functional domains, influencing others as needed **Shareholder Accountabilities:** + Adheres to enterprise frameworks and methodologies that relate to business management activities for own area + Actively manages relationships with corporate and/or control functions and ensure alignment with enterprise and/or regulatory requirements + Keeps abreast of emerging issues, trends, and evolving regulatory requirements and assess potential impacts to the Bank + Assesses / identifies key issues and escalate to appropriate levels and relevant stakeholders where required + Maintains a culture of risk management and control, supported by effective processes and sound infrastructure an in alignment with risk appetite + Ensures business operations are in compliance with applicable internal and external requirements (e.g. financial controls, segregation of duties, transaction approvals, and physical control of assets). + Participates in cross-functional / enterprise initiatives as a subject matter expert helping to identify risk / provide guidance for complex situations + Leads relevant governance meetings or committees and related deliverables / outcomes + Leads / facilitates and/or implements action/remediation plans to address performance/risk/governance issues **Employee/Team Accountabilities:** + Provides thought leadership and/or industry knowledge for own area of expertise + Supports a positive work environment that promotes service to the business, quality, innovation and teamwork and ensure timely communication of issues/ points of interest + Identifies and recommends opportunities to enhance productivity, effectiveness and operational efficiency + Works effectively as a team, supporting other members of the team in achieving business objectives and providing client services + Participates in knowledge transfer within the team and business units **Who We Are:** TD is one of the world's leading global financial institutions and is the fifth largest bank in North America by branches/stores. Every day, we deliver legendary customer experiences to over 27 million households and businesses in Canada, the United States and around the world. More than 95,000 TD colleagues bring their skills, talent, and creativity to the Bank, those we serve, and the economies we support. We are guided by our vision to Be the Better Bank and our purpose to enrich the lives of our customers, communities and colleagues. TD is deeply committed to being a leader in customer experience, that is why we believe that all colleagues, no matter where they work, are customer facing. As we build our business and deliver on our strategy, we are innovating to enhance the customer experience and build capabilities to shape the future of banking. Whether you've got years of banking experience or are just starting your career in financial services, we can help you realize your potential. Through regular leadership and development conversations to mentorship and training programs, we're here to support you towards your goals. As an organization, we keep growing - and so will you. **Our Total Rewards Package** Our Total Rewards package reflects the investments we make in our colleagues to help them and their families achieve their financial, physical and mental well-being goals. Total Rewards at TD includes base salary and variable compensation/incentive awards (e.g., eligibility for cash and/or equity incentive awards, generally through participation in an incentive plan) and several other key plans such as health and well-being benefits, savings and retirement programs, paid time off (including Vacation PTO, Flex PTO, and Holiday PTO), banking benefits and discounts, career development, and reward and recognition. Learn more (*************************************** **Additional Information:** We're delighted that you're considering building a career with TD. Through regular development conversations, training programs, and a competitive benefits plan, we're committed to providing the support our colleagues need to thrive both at work and at home. **Colleague Development** If you're interested in a specific career path or are looking to build certain skills, we want to help you succeed. You'll have regular career, development, and performance conversations with your manager, as well as access to an online learning platform and a variety of mentoring programs to help you unlock future opportunities. Whether you have a passion for helping customers and want to expand your experience, or you want to coach and inspire your colleagues, there are many different career paths within our organization at TD - and we're committed to helping you identify opportunities that support your goals. **Training & Onboarding** We will provide training and onboarding sessions to ensure that you've got everything you need to succeed in your new role. **Interview Process** We'll reach out to candidates of interest to schedule an interview. We do our best to communicate outcomes to all applicants by email or phone call. **Accommodation** TD Bank is an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, age, disability, status as a protected veteran or any other characteristic protected under applicable federal, state, or local law. If you are an applicant with a disability and need accommodations to complete the application process, please email TD Bank US Workplace Accommodations Program at *************** . Include your full name, best way to reach you and the accommodation needed to assist you with the applicant process. Federal law prohibits job discrimination based on race, color, sex, sexual orientation, gender identity, national origin, religion, age, equal pay, disability and genetic information.