Business advisor jobs in Wilmington, DE - 423 jobs

Gateway Search has an exciting Business Developer opportunity with a dynamic and growing regional consulting firm that delivers high -impact advisory services to middle -market companies across a range of industries. The firm specializes in strategic, financial, and operational consulting-and is known for building lasting client relationships and driving measurable growth. As they continue to expand, they're looking for a results -driven Business Developer to help lead their growth efforts by identifying new client opportunities, cultivating relationships with C -level decision -makers, and effectively positioning the firm's service offerings. Key Highlights of the Role: Lead strategic outreach and relationship -building with prospective and existing clients Develop and execute a sales plan aligned with growth goals Collaborate with consulting teams to create tailored solutions Represent the firm at industry events and networking functions Leverage CRM tools to manage the sales pipeline and provide insights to leadership RequirementsWhat They're Looking For: 5+ years of experience in business development or consultative B2B sales (professional services preferred) Proven track record working with middle -market clients Strong communication, negotiation, and strategic thinking skills Comfortable working independently and cross -functionally Bachelor's degree required; MBA preferred Benefits Vision, Dental, Medical, Flexible Time Off, 401K Experience Level Mid -Level (5-8 yrs) Base Salary: $85,000-$110,000 Bonus/Commission: $20,000-$40,000 Total Compensation: $105,000-$150,000 Senior (8-12 yrs) Base Salary: $110,000-$140,000 Bonus/Commission $30,000-$60,000 Total Compensation: $140,000-$200,000+

Häfele America Co. at a quick glance: We are the largest subsidiary of a privately-held, a global powerhouse in the areas of LED lighting, cabinet and furniture hardware, kitchen organization and much more. We offer a strong benefits package including medical, dental, 401(k) with company match, employee discount and other perks. There's a very good reason 41% of our employees have been with us for over ten years - we hire the best, treat people well and truly provide a family atmosphere that works hard and plays to win. KEY RESPONSIBILITIES include the following. Other duties may be assigned. Defined territory consists of kitchen manufacturers and dealers in Eastern, PA. (Role is based is based in PA) Grow and manage sales within assigned accounts, developing strong relationships across Purchasing, Operations, Marketing, and Leadership. Identify and pursue new business with underdeveloped kitchen manufacturers. Promote Hafele's full product offering, including functional hardware, kitchen organization, fasteners, and lighting. Collaborate with internal teams and dealer networks to ensure aligned efforts and maximize sales opportunities. Communicate regularly with Hafele colleagues on dealer feedback, product needs, and market trends. Present new product launches and act as knowledgeable resource on Hafele's solutions. Participate in team strategy sessions and contribute ideas for growth and improvement. Assist in developing "customer specific products" What We're Looking for: A professional, proactive team player with strong relationship-building and communication skills. Someone who thrives in a collaborative, solution-oriented environment. A representative of Hafele who acts with integrity and understands the value we bring to the kitchen and bath industry. EDUCATION and/or EXPERIENCE Bachelor's degree from four-year College or University. Considerations will be made for additional training programs or equivalent combination of education and experience. This individual must have a degree of applicable market and product knowledge. Position requires high degree of comfort in dealing with various level of decision-makers. COMPUTER SKILLS Proficiency in MS Excel, Outlook, PowerPoint and Word. Experience with Salesforce is a plus.

Are you someone who loves helping people reach their business goals? Are you a great problem solver? If you answered "yes" to these questions, keep reading. The SMB Team is the fastest-growing digital marketing and coaching business for attorneys nationwide and we are looking for a Business Strategist and Advisor to join our Coaching Team! WHAT'S IN IT FOR YOU? 📈 An opportunity to be a part of the #1 Fastest Growing Legal Marketing & Coaching Company in the U.S. 🦷 BENEFITS - We pay for 75% of your Medical, Dental, Vision insurance for YOU and YOUR FAMILY. ☀️ FLEXIBLE VACATION TIME - We encourage you to take time to recharge so you can be your best here at work. 💡 EDUCATION - Team member education and learning budget on courses, events and books. 🌴 FUN - Company activities, outings, and retreats. 💲 INVESTMENTS - 401(k) with a 3% Match. 💻 WORK STYLE - WFH or come to the office. The choice is yours! The salary for this role is $90,000-$95,000 annually. Key Responsibilities: Hold monthly client accountability calls to hold clients accountable to their goals. This may include problem solving, giving advice based on our frameworks, or just listening. Maintain/enforce program standards and frameworks to ensure client success. Execute new program initiatives as they develop. We move quickly and try new things (while maintaining our core systems). If that's not how you like to operate, this probably isn't the role for you. Identify client struggles and offer solutions and services to assist. This could include marketing or virtual assistant services that we offer. Assist with planning and participating in weekly coaching calls and events. This includes weekly group coaching calls, client masterminds when needed, quarterly workshops, and one-off workshops. Requirements 5 - 7 years experience as a successful business coach, with experience holding clients accountable, overseeing a budget, goal setting, KPI tracking, and a history of business growth. A Coaching Accreditation is required. Familiarity with EOS/Traction and/or Scaling-Up strongly preferred. Excellent written and verbal communication skills. We don't expect you to be the next great novelist or public speaker, but we do expect you to be able to effectively communicate information that may not be familiar to our clients. MUST have strong interpersonal skills. We are looking for individuals who can build great relationships with our clients. Proficient with the Google Suite. Solid organization skills so that you can effectively manage your daily, weekly, and monthly to-do list. Ability to thrive in a fast-paced environment and think quickly on your feet in order to adapt to client situations or changes in the company. Proactive and resourceful in all aspects of your role. Coachable Attitude: Must possess the ability to be coached and open to feedback, demonstrating a commitment to personal and professional growth. Collaborative & Adaptable Mindset: Must be a team player who can set aside ego to work effectively with colleagues and clients. Quick Learner: Ability to rapidly grasp new processes and adapt to a fast-paced, innovative environment. Initiative: Willingness to take initiative on tasks, regardless of size, both within the department and for clients. Process Improvement: Eagerness to participate in and collaborate on enhancing internal processes for greater efficiency and effectiveness. Budget Management Experience: Must have managed a budget of at least $2.5M Reading Requirements: If not already familiar with these books, the employee must read them within the first month of employment. Must have read and be familiar with the following books: Scaling Up by Verne Harnish The E-Myth Revisited by Michael E. Gerber Traction by Gino Wickman Good to Great by Jim Collins Law Firm Growth Accelerator by Bill Hauser and Andy Stickel Benefits SMB Team is a rapidly-growing marketing agency and coaching business for lawyers. After four years of 300% year-over-year growth, we have quickly become one of the top brands in the legal industry. Bottom Line: We change lives. Want proof? Read our Google My Business reviews. There are three parts to our business: Educational Brand: We currently run the most prominent talk show in the legal industry. Every week, we get hundreds of lawyers on our webinars by interviewing top thought leaders (as seen on our YouTube). The goal is to become THE source of education for lawyers. Marketing Services: We offer a full suite of marketing services to our clients, including PPC, SEO, Website Design, Video, and Social Media management. Our goal is to scale our services business to over $15M in revenue in 2023. Coaching Services: We have a rapidly-growing, Philadelphia-based coaching program for lawyers. In our first year, we built our coaching business into a multi-seven-figure business. Our program has been identified as the most comprehensive coaching program for attorneys, and we plan to double the size of our clients in the next year. The SMB Team is an Equal Opportunity Employer. The policy of The SMB Team is to extend opportunities to qualified applicants and employees on an equal basis regardless of an individual's race, color, gender, age, national origin, religion, citizenship status, marital status, sexual orientation, gender identity, transgender status, physical or mental disability, protected veteran status, genetic information, pregnancy, or any other categories protected by applicable federal, state or local laws. The SMB Team is an Equal Opportunity Employer - Minority/Female/Disabled/Protected Veterans

**The Best Teams are Created and Maintained Here.** + The Business Developer (BD) works to improve BrightView's market position and achieve profitable financial growth. This role helps to achieve long-term organizational strategic goals, builds key customer relationships, identifies business opportunities, negotiates, and closes business deals and maintains extensive knowledge of current market conditions. The Business Developer manages the sales pipeline from prospecting to closing and is responsible for full cycle landscape and, depending on region, snow sales. The Business Developer collaborates and works with partners including operations, finance, marketing, and more to manage responses to bids in an effort to meet sales targets. **Duties and Responsibilities:** + Work with prospective customers to discover their "points of pain" and develop solutions. + Accurately forecast sales deliverables and KPI's + Achieve sales goals and be able to work independently + Perform sales prospecting using consultative sales techniques to build long-standing business relationships; marketing; pricing + Prepare and conduct heavy phone prospecting, sales presentations, virtual demonstrations, and handle contract negotiations with minimum supervision + Identify customer needs and utilize solution-based selling techniques to fully demonstrate value of BrightView services + Cultivate and maintain relationships with prospects and existing clients + Build and maintain trust-based professional relationships with key decision makers + Plan daily and hit specific activity benchmarks and close business + Log activity consistently and reliably in CRM (Salesforce) + Work in a fast-paced environment while operating with a high sense of urgency + Communicate proactively with all decision makers and influencers **Education and Experience:** + Bachelor's Degree or equivalent work experience + Extensive face-to-face (B2B) selling experience at the mid-to-senior levels, 3-5 years of experience + Experience managing multiple projects and able to multi-task in a large territory + Proficient with computer programs including MS Word, Excel, Outlook, and PowerPoint + Experience with a CRM or SFA tool + Proven track record of sales goal attainment and pipeline management + Highly competitive, positive, and results driven + Excellent presentation skills + Excellent oral and written communication skills to build client-centric and solution/value-based proposals + Working experience with social media + Local knowledge and contacts in one or more market segments preferred + Ability to be self-motivated and self-directed + Experience in the service industry with commercial contract sales desirable **Physical Demands/Requirements:** + Constant operation of a computer and other office equipment such as a laptop, cell phone and sales programs/tools + Position is a combination of mobile and sedentary work; must be able to remain in a stationary position for extended periods of time + Customarily and regularly spends more than half of the time working away from BrightView's places of business selling and obtaining orders or contracts for BrightView's services. + Ability to travel by car, train, and plane + Position needs to be able to traverse uneven grounds and walk on jobsites with clients and branch teams for periods of time up to 4 hours **Work Environment:** + Works both indoors and outdoors + Field based position, combination of office and customer facing. **_BrightView Landscapes, LLC is an Equal Opportunity and E-Verify Employer._** **_This job description is subject to change at any time._** **_BrightView offers a suite or health, wellness, and financial benefits to full-time team members. Benefits offerings for full-time team members include medical, dental, and vision insurance, ancillary and voluntary products, a 401k savings plan with employer contributions, and 6 to 9 company paid holidays per year. Employees may also be eligible to receive paid time off for vacation and/or sick leave, tuition reimbursement, and/or potential variable pay opportunities based on position and performance. A detailed benefits package will be provided during the interview process_** _._ _It's Not Just a Team. It's One BrightView._

Women's Health Business Specialist - Newark, DE Developing innovative therapies is one of the most challenging, most essential, and personally rewarding fields in science. This is the most exciting time to be a part of Astellas, a company with a uniquely collaborative and patient-focused culture. There's something special about working at Astellas. It's reflected in our focus on the people we serve, the way we treat each other and the results we achieve together as a company. Astellas is announcing a Women's Health Business Specialist opportunity in the Newark, DE area. The Role Achieve territory sales goals by promoting Astellas products and services to physicians and other medical personnel within assigned geography. Educate customers on the use, characteristics, advantages, indicated treatments and all other developments related to promoted products. Professionally represent Astellas in the field and ensure high levels of visibility and customer satisfaction in territory. Maintain effective communication and relationships with key external and internal customers. Flexible grade level based on candidate background and skillset. Primary Responsibilities Effectively promote and educate targeted physicians/HCPs on the use of Astellas' products through one-on-one meetings and group presentations, company-approved promotional speaker programs, and other company-approved means. Work 5 days in the field each week, supported by office time as needed for call planning, customer follow-up, preparing presentations, making appointments, report generation, etc. Ensure solid performance levels of call and field productivity. Meet Call Plan expectations and achieve territory product sales goals while adhering to all APUS-defined ethical sales practices, Compliance guidelines, and required promotional regulations Execute company-approved Product Marketing plans and territory/regional business plan activities Support targeted customers using company-approved resources, sales materials, and promotional activities/programs/initiatives as identified by Sales Management Coordinate promotional efforts with peers across franchises and co-promotion alliance partners as appropriate. This includes appropriately managing/maintaining all company equipment and company-approved promotional materials (e.g., sales materials, company literature, product samples, etc.) according to defined company Compliance guidelines Achieve territory product sales goals while adhering to all APUS-defined ethical sales practices, Compliance guidelines, and required promotional regulations Ensure territory sales strategy execution using annual territory business plan, regional business plan, and call activity reports Accurately report/submit sales call activities, territory expenses and written reports and within deadline as defined by Astellas or the Regional Sales Manager Attend all company-sponsored sales and medical meetings as directed by company management. Additional duties as needed Quantitative Dimensions This position is responsible for achieving both territory product sales goals and territory sales activity goals through company defined metrics. Organizational Context It is important for individuals in this position to actively pursue continuous learning and professional sales development on effective sales and communication techniques and product/therapeutic area knowledge. This position: Is a customer facing sales position Reports to Regional Sales manager Maintains territory responsible for managing Astellas' products Partners with counterparts, teammates, and cross functional colleagues as appropriate Balance's territory and regional work and projects, while maintaining solid level of sales performance Exhibits strong level of skill in competencies Demonstrates sales influence within territory and at times within region

Introducing Rezedent...the simplest Property Management Platform for small to mid-size Property Managers, Independent Landlords and renters that can be free to use. The platform facilitates full feature set of property management tools, communications between management and tenants with a social component for tenants to connect within their rental communities. Among all the Property Management features, Maintenance, also included is a secure free online payments portal accepting electronic check or credit card, with email and mobile payment options, favored by Millennials. Job Description Are you a college student looking to make extra money while in school this year. The Business Development Account Manager (RezX) position is all about evangelizing, promoting and signing up small to mid size property managers, independent landlords and renters for Rezedent.com online tool suite. Rez X Duties: Farm and Hunt new Business Development of small, mid-size and independent landlords. Set up webinars, online demos, conference calls. Demo the tool to prospects Sign Up PM PM to Add Properties and make sure they are activated. Have PM complete Legal Entity and Merchant Account(s) Manage Units: upload and data entry of all resident emails, rents, late fees etc. A template is provided for larger unit properties. Maintain relationship with PM and make sure they are integrated into Customer Success team. Maintain Contacts in assigned Rezedent HubSpot account Qualifications We are looking for people with the following qualities: • Has an interest in Property Management, Real Estate and Software as a Service. • Upbeat, energetic personalities - We want folks who bring the fun! Can you make a New Yorker slow down? • Go-getter- We ' re looking for someone who is ambitious and isn ' t afraid to approach new people. • Reliable - You will work with partners and teams. Can your teammates count on you? • Some sales experience/willingness to learn- Rezedent is unique, and we need you to explain just why that is. Can you educate the people? Additional Information We look forward to speaking with you. This position can be worked on remotely. If you are in the area of Newark, DE and University of Delaware, please contact us immediately as we are conducting Face to Face interviews 7/27 and 7/28.

ITC WORLDWIDE is seeking a dynamic and experienced Microsoft Business Applications Senior Sales Consultant WFH or an ITC field office Are you passionate about selling business applications solutions that empower organizations to achieve more? Do you have a proven track record of delivering results in a complex and competitive market? Do you have experience with Microsoft Dynamics 365 Finance & Operations or other ERP systems? If so, we want to hear from you. To be successful in this position you will possess the following attributes: Motivated and proactive professional with previous experience in end-to-end sales within Microsoft or equivalent Enterprise Applications. 5+ years face-to-face selling experience - Microsoft product suite expertise including D365, PowerApps and Business Central is highly regarded. Demonstrated ability to hunt new business opportunities. Ability to build and foster strong customer relationships in existing customer base. A strong customer-centric approach and ability to network across a complex organization. Skills in managing multiple commercial processes (new business sales), forecasting precisely and identifying challenges to positive commercial outcomes. Develop and execute a sales strategy in designated territories and work with both vendor and Industry teams to execute. Arrange and conduct customer meetings, serve as trusted advisor by understanding a customer's existing and future digital transformation roadmap and driving the sales. Strong networking skills and industry experience Ability to drive new business and get engaged with lead generation. Liaising with solution consultants to drive correct business outcomes. Desire to be involved in a rapidly growing business and take a leadership role in helping it thrive. Strong personality motivated by continual improvement and self-development Responsibilities: Develop and execute sales strategies to grow revenue and market share in the Finance & Operations segment. Build and maintain strong relationships with key decision makers and influencers across various industries and geographies. Understand customer needs and pain points and propose value-added solutions that leverage Microsoft's D365 platforms and applications. Collaborate with delivery and pre-sales teams to ensure proposed solutions align with client requirements. Working with Marketing and Business Development personnel to help develop lead generation campaigns along with target marketing to specific verticals. · Manage the entire sales cycle, including prospecting, negotiations, and contracting Develop and nurture a robust pipeline of prospects to achieve and exceed sales targets Leverage your sales knowledge and existing Microsoft ecosystem network Qualifications: Minimum of 5 years of experience in selling enterprise software solutions, preferably in the ERP domain Strong knowledge of Microsoft Dynamics 365 Finance & Operations or other ERP systems and their business benefits Excellent communication, presentation, and negotiation skills Ability to work independently and as part of a team in a fast-paced and dynamic environment. Bachelor's degree in business, finance, or related field Prior consulting services sales experience required, and an understanding of Microsoft's Business Applications preferred (Sales, Service, Marketing, Finance, HR, Supply Chain, and Project Operations) Package Details Contract W2 role for an experienced Tech Seller! Base Salary (Draw) W2 Commissioned: from 1-3% on lifetime Support + Bonus on Managed Services +Cash Bonus What's in it for you Qualified Leads Technical Sales & Service Support Product Selling Training Provided Dynamics 365 - CRM Dynamics 365 - Business Central Microsoft 365 ISV Solutions (Offers) Neural Impact Sales Optimization Training Differentiation & Engagement Effective Discovery & CIO Engagement Project Impact & Objection Handling $ 150,000.00 (US Dollar) BIzzApp Sales 2. Acct exec 3. services & support consult

At Johnson & Johnson, we believe health is everything. Our strength in healthcare innovation empowers us to build a world where complex diseases are prevented, treated, and cured, where treatments are smarter and less invasive, and solutions are personal. Through our expertise in Innovative Medicine and MedTech, we are uniquely positioned to innovate across the full spectrum of healthcare solutions today to deliver the breakthroughs of tomorrow, and profoundly impact health for humanity. Learn more at ******************* Job Function: Pharmaceutical Sales Job Sub Function: Sales - Immunology (Commission) Job Category: Professional All Job Posting Locations: Cherry Hill, New Jersey, United States of America, Toms River, New Jersey, United States, Wilmington, Delaware, United States Job Description: We are searching for the best talent for Senior Area Business Specialist to be in South New Jersey. Territory includes: Cherry Hill, Toms River, Cape May Court House, and Marlton NJ. Also Newark and Wilmington DE About Immunology Our expertise in Innovative Medicine is informed and inspired by patients, whose insights fuel our science-based advancements. Visionaries like you work on teams that save lives by developing the medicines of tomorrow. Our Immunology team leads in the development of transformational medicines for immunological disorders and illnesses. You can influence where medicine is going by restoring health to millions of people living with immune diseases. Join us in developing treatments, finding cures, and pioneering the path from lab to life while championing patients every step of the way. Learn more at *******************/innovative-medicine As the Area Business Specialist (ABS), you will: Ensure appropriate identified new and existing patients have access to pharmaceutical products which minimize pre and post needle attrition. Ensure a mix of viable sites of care are available in the local marketplace, educating practices on appropriate efficiency practices to infuse the pharmaceutical product(s) to remain viable, updating practices on key private and public payer changes that impact infusion process, ensure staff in infusion clinics have been trained using company approved materials to deliver pharmaceutical product(s) in a safe and efficient manner, educate providers on patient assistance programs that are available to assist patients financially. Use discretion and judgment to execute the company's brand strategy and tactics within the assigned customer segment, which may include securing and preserving patient access to pharmaceutical product(s) in the optimal site of care for the patient and provider. Approach each customer from a total account management perspective, by leveraging resources appropriately, collaborating with business partners and accurately articulating the value proposition for the customer. Assist members of sales force (e.g., Immunology Specialists, District Managers) in all aspects of product promotion, including but not limited to product access, pull-through and reimbursement. Mentor doctors and staff on how to develop and implement an In-Office Infusion program including overall operations management, scheduling, staffing, pre-authorization, reimbursement, capacity management, inventory management, and infusion management/efficiencies. Train appropriate clinical staff re: technical aspects of infusing the pharmaceutical product(s) including reconstitution, admixture, administration, monitoring, and adverse event management and reporting. Serve as a resource to territory's accounts and JJIM staff regarding local, regional and national payer policies; reimbursement regulations and processes (i.e., eligibility and benefit verification, pre-authorization, billing, coding, claims, and appeals/grievances); practice management; Medicare and Medicaid rules and regulations; OSHA; HIPAA; and state-specific clinical staff licensing / certification requirements for product compounding, admixture, administration and monitoring. Required Qualifications: A minimum of a bachelor's degree A valid driver's license issued in one (1) of the fifty (50) United States The ability to travel, up to 50% of the time Reside in the geography and/or willing to relocate to it A minimum of three (3) years of successful pharmaceutical, biologic / biotech or medical device sales experience with a minimum of one (1) year of specialty sales experience is required. Preferred Qualifications: A working knowledge of reimbursement, payer, provider and infusion operations is strongly preferred Experience selling an injectable / infused product Working knowledge of the immunology, rheumatology, and/or gastroenterology field(s) Johnson & Johnson is an Equal Opportunity Employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, age, national origin, disability, protected veteran status or other characteristics protected by federal, state or local law. We actively seek qualified candidates who are protected veterans and individuals with disabilities as defined under VEVRAA and Section 503 of the Rehabilitation Act. Johnson & Johnson is committed to providing an interview process that is inclusive of our applicants' needs. If you are an individual with a disability and would like to request an accommodation, external applicants please contact us via *******************/contact-us/careers . internal employees contact AskGS to be directed to your accommodation resource. At Johnson & Johnson, we want every candidate to feel supported throughout the hiring process. Our goal is to make the experience clear, fair, and respectful of your time. Here's What You Can Expect Application review: We'll carefully review your CV to see how your skills and experience align with the role. Getting to know you: If there's a good match, you'll be invited to complete a short-recorded video interview, giving you the chance to share more about yourself. If successful, a recruiter will also reach out by phone to walk you through the process and answer any questions. Interviews with the team: If you move forward, you'll meet with the hiring manager (and possibly others on the team) in one or two interview rounds, depending on the role. Staying informed: We know waiting can be hard, so our recruitment team will keep you updated and make sure you know what to expect at each step. Final steps: For successful candidates, you will need to complete country-specific checks before starting your new role. We will help guide you through these. At the end of the process, we'll also invite you to share feedback in a short survey - your input helps us continue improving the experience for future candidates. Thank you for considering a career with Johnson & Johnson. We're excited to learn more about you and wish you the best of luck in the process! #RPONA Required Skills: Preferred Skills: Business Development, Clinical Experience, Communication, Cross-Functional Collaboration, Customer Centricity, Customer Retentions, Data Savvy, Developing Partnerships, Immunology, Market Knowledge, Performance Measurement, Pharmaceutical Industry, Pharmaceutical Sales Marketing, Problem Solving, Product Knowledge, Relationship Building, Sales, Sales Projections, Sales Trend Analysis, Strategic Sales Planning The anticipated base pay range for this position is : $111,000-$178,250 annually Additional Description for Pay Transparency:

At Johnson & Johnson, we believe health is everything. Our strength in healthcare innovation empowers us to build a world where complex diseases are prevented, treated, and cured, where treatments are smarter and less invasive, and solutions are personal. Through our expertise in Innovative Medicine and MedTech, we are uniquely positioned to innovate across the full spectrum of healthcare solutions today to deliver the breakthroughs of tomorrow, and profoundly impact health for humanity. Learn more at ******************* Job Function: Pharmaceutical Sales Job Sub Function: Sales - Immunology (Commission) Job Category: Professional All Job Posting Locations: Cherry Hill, New Jersey, United States of America, Toms River, New Jersey, United States, Wilmington, Delaware, United States Job Description: We are searching for the best talent for Senior Area Business Specialist to be in South New Jersey. Territory includes: Cherry Hill, Toms River, Cape May Court House, and Marlton NJ. Also Newark and Wilmington DE About Immunology Our expertise in Innovative Medicine is informed and inspired by patients, whose insights fuel our science-based advancements. Visionaries like you work on teams that save lives by developing the medicines of tomorrow. Our Immunology team leads in the development of transformational medicines for immunological disorders and illnesses. You can influence where medicine is going by restoring health to millions of people living with immune diseases. Join us in developing treatments, finding cures, and pioneering the path from lab to life while championing patients every step of the way. Learn more at *******************/innovative-medicine As the Area Business Specialist (ABS), you will: Ensure appropriate identified new and existing patients have access to pharmaceutical products which minimize pre and post needle attrition. Ensure a mix of viable sites of care are available in the local marketplace, educating practices on appropriate efficiency practices to infuse the pharmaceutical product(s) to remain viable, updating practices on key private and public payer changes that impact infusion process, ensure staff in infusion clinics have been trained using company approved materials to deliver pharmaceutical product(s) in a safe and efficient manner, educate providers on patient assistance programs that are available to assist patients financially. Use discretion and judgment to execute the company's brand strategy and tactics within the assigned customer segment, which may include securing and preserving patient access to pharmaceutical product(s) in the optimal site of care for the patient and provider. Approach each customer from a total account management perspective, by leveraging resources appropriately, collaborating with business partners and accurately articulating the value proposition for the customer. Assist members of sales force (e.g., Immunology Specialists, District Managers) in all aspects of product promotion, including but not limited to product access, pull-through and reimbursement. Mentor doctors and staff on how to develop and implement an In-Office Infusion program including overall operations management, scheduling, staffing, pre-authorization, reimbursement, capacity management, inventory management, and infusion management/efficiencies. Train appropriate clinical staff re: technical aspects of infusing the pharmaceutical product(s) including reconstitution, admixture, administration, monitoring, and adverse event management and reporting. Serve as a resource to territory's accounts and JJIM staff regarding local, regional and national payer policies; reimbursement regulations and processes (i.e., eligibility and benefit verification, pre-authorization, billing, coding, claims, and appeals/grievances); practice management; Medicare and Medicaid rules and regulations; OSHA; HIPAA; and state-specific clinical staff licensing / certification requirements for product compounding, admixture, administration and monitoring. Required Qualifications: A minimum of a bachelor's degree A valid driver's license issued in one (1) of the fifty (50) United States The ability to travel, up to 50% of the time Reside in the geography and/or willing to relocate to it A minimum of three (3) years of successful pharmaceutical, biologic / biotech or medical device sales experience with a minimum of one (1) year of specialty sales experience is required. Preferred Qualifications: A working knowledge of reimbursement, payer, provider and infusion operations is strongly preferred Experience selling an injectable / infused product Working knowledge of the immunology, rheumatology, and/or gastroenterology field(s) Johnson & Johnson is an Equal Opportunity Employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, age, national origin, disability, protected veteran status or other characteristics protected by federal, state or local law. We actively seek qualified candidates who are protected veterans and individuals with disabilities as defined under VEVRAA and Section 503 of the Rehabilitation Act. Johnson & Johnson is committed to providing an interview process that is inclusive of our applicants' needs. If you are an individual with a disability and would like to request an accommodation, external applicants please contact us via *******************/contact-us/careers . internal employees contact AskGS to be directed to your accommodation resource. At Johnson & Johnson, we want every candidate to feel supported throughout the hiring process. Our goal is to make the experience clear, fair, and respectful of your time. Here's What You Can Expect Application review: We'll carefully review your CV to see how your skills and experience align with the role. Getting to know you: If there's a good match, you'll be invited to complete a short-recorded video interview, giving you the chance to share more about yourself. If successful, a recruiter will also reach out by phone to walk you through the process and answer any questions. Interviews with the team: If you move forward, you'll meet with the hiring manager (and possibly others on the team) in one or two interview rounds, depending on the role. Staying informed: We know waiting can be hard, so our recruitment team will keep you updated and make sure you know what to expect at each step. Final steps: For successful candidates, you will need to complete country-specific checks before starting your new role. We will help guide you through these. At the end of the process, we'll also invite you to share feedback in a short survey - your input helps us continue improving the experience for future candidates. Thank you for considering a career with Johnson & Johnson. We're excited to learn more about you and wish you the best of luck in the process! #RPONA Required Skills: Preferred Skills: Business Development, Clinical Experience, Communication, Cross-Functional Collaboration, Customer Centricity, Customer Retentions, Data Savvy, Developing Partnerships, Immunology, Market Knowledge, Performance Measurement, Pharmaceutical Industry, Pharmaceutical Sales Marketing, Problem Solving, Product Knowledge, Relationship Building, Sales, Sales Projections, Sales Trend Analysis, Strategic Sales Planning The anticipated base pay range for this position is : $111,000-$178,250 annually Additional Description for Pay Transparency:

What We Do We calm the confusion of IT by guiding the connection between people and technology. If a customer is looking for a better way to manage their warehouse inventory, equip their workforce, or secure their data, we make it happen. All it takes is finding the right combination of tech hardware, software, cloud solutions, and support services. That's what we do. We're the IT Department's IT Department. Who We Are Our team is made stronger by a multitude of backgrounds, experiences, and perspectives. It's what makes Connection unique-what drives us to innovate and create technology solutions that stand apart from the crowd. We'd love for you to be a part of that fabric, to share your ideas and experiences with a team that thrives on fresh thinking, creativity, and helping others. Why You Should Join Us You'll find supportive teammates and a rewarding career at Connection-plus great benefits. We take pride in supporting employees with a total rewards package that provides financial, emotional, and physical resources for you and your family. Our compensation, 401k plans, medical insurance, and other benefits are progressive and competitive. We value the importance of our employees' emotional wellbeing. To support employees, we provide free therapy visits, mental health coaching and tools, and meditation resources. You'll also enjoy a generous paid time off package that includes not only vacation and sick time, but also Wellness and Volunteer Time Off days. Applicants must be authorized to work for any employer in the U.S. We are unable to sponsor or take over sponsorship of an employment visa at this time. Responsibilities Primary Job Duties • Works directly with Account Managers and Sales Managers to identify sales opportunities in the practice area through book of business reviews. • Collaborates on business development and communications with the sales teams. • Increases knowledge of technology in respective practice area, keeps abreast of changes, and maintains or achieves certifications for professional development. • Assists in the creation and presentation of technical training to our selling organizations. • Act as the subject matter expert to Account Managers for pre-sales questions relating to their assigned products(s). • Proactively engages with partner field community and balances the needs of Connection and the partner. • Must be a known problem solver and act as an advocate for the customer. • Exceptional ability to identify, establish, and develop relationships with new and existing clients • Performs all other duties or special projects as assigned. Min USD $58,000.00/Yr. Max USD $73,563.00/Yr. Qualifications Because of the possibility for fraudulent job postings on many popular job boards, please be advised that Connection will never offer a position of employment without a complete interview process and communication with a “live person".

. Must be willing to travel, with overnight hotel stays, up to 5 nights per week (every week). Reynolds and Reynolds is looking for experienced automotive professionals to join our consulting team. Our superior software solutions, our award-winning sales, service, and support have made us one of the most recognized and respected companies in the automotive industry. As an Automotive Business Consultant your primary focus will be to establish professional relationships with customers and help their businesses become more efficient, effective, and profitable. You will work with dealership personnel to identify trouble areas within the dealership and then use established and proven consulting services programs, as well as your industry knowledge, to help solve these issues. Once a project is complete, you will follow-up with customers to maintain relationships and provide ongoing 'fee for service' support and problem resolution. By helping these customers become successful in the different areas of the dealership, you will build trust that will further drive consulting services sales. If you are looking for an opportunity to utilize your automotive skills and make a difference for automotive dealerships across the country, please apply today!","job_category":"Consulting","job_state":"PA","job_title":"Automotive Business Consultant","date":"2026-01-04","zip":"19019","position_type":"Full-Time","salary_max":"80,000. 00","salary_min":"60,000. 00","requirements":"High School Diploma or equivalent; Bachelor's preferred but not required~^~5+ years of automotive dealership experience (Sales Associate\/Representative, Service Advisor, Sales Manager, Internet Sales Manager, Business Development Manager, F&I Manager, Controller\/Office Manager, Parts Manager, Service Manager, Fixed Operations Director, or GM)~^~Must be willing to travel extensively with overnight hotel stays up to 5 nights per week (every week). ~^~Must have reliable transportation as well as a valid driver's license, with fewer than 2 moving violations in the last three years and no OVI\/DUI\/DWI violations in the last five years. ~^~Must have reliable home internet with sufficient bandwidth for video conferencing","training":"Our training consists of time with experienced consulting and sales representatives in the field for approximately 90 days, online courses completed in your home office, and classroom instruction through our offices in Dayton and Houston. Your compensation during training will be a $60,000-63,000 base salary. You will be eligible for quarterly bonuses after the 9 month training period. Total targeted income after training (including base and bonuses) is $80,000+. ","benefits":"We strive to offer an environment that provides our associates with the right balance between work and family. We offer a comprehensive benefits package including: - Medical, dental, vision, life insurance, and a health savings account - 401(k) with up to 6% matching - Paid vacation and sick days - Eight paid holidays - Referral bonuses - Professional development and training - Promotion from within Reynolds and Reynolds promotes a healthy lifestyle by providing a non-smoking environment. Reynolds and Reynolds is an equal opportunity employer. ","

Job Description Alcott HR is seeking an experienced Outside Sales professional to join our team as a Senior Business Consultant. As a Professional Employer Organization, we offer comprehensive Human Resources support to our clients. In this role, you will spearhead the launch of our services in the Philadelphia market, serving as the primary sales representative. Your main responsibilities will include identifying potential business opportunities, fostering strong relationships throughout the area, and engaging with potential clients to understand their needs. You will work closely with business owners and key decision-makers to provide tailored HR solutions. We've got a lot to offer: Uncapped commission and unlimited territory Ability to sell any of our offerings to any industry (PEO, ASO, HRO, HR Consulting) Competitive base salary plus an industry-leading commission plan with escalating rates Remote schedule Here's what you'll do: Develop and maintain relationships with business owners and key decision makers. Leverage your professional network to generate referral business and expand Alcott HR's client base Network with business advisors to educate them on Alcott HR's offerings and benefits for their clients Prospect and network for business owners and key decision makers to explain how Alcott HR can help their company to grow Complete required sales process, paperwork and finalize new client contracts Travel throughout our open territory. No set territories with Alcott HR! Exceed sales goals determined by management, and reach your maximum earning potential You are someone who has: 2+ years of business-to-business sales experience with a focus on relationship-building Successful and stable track record of excellence Ability to aggressively prospect for new business A positive and consultative mindset when engaging with clients Exceptional verbal and written communication abilities, particularly with C-level executives Ability to work independently, as well as being a collaborative team member Expertise in consultative and solution-oriented sales techniques A driven, self-starter attitude with strong time management skills We definitely want to talk to you if you have the following: Demonstrated ability in cold calling and prospecting with a positive and persistent style Proven ability to be a "hunter gatherer" within the C-level market PEO and/or Employee Benefit sales experience We know you have your choice of roles for your next opportunity. Here's why we think you should choose Alcott HR: You'll be joining a PEO & HR company that is poised for rapid growth, taking a new and exciting service model and message to underserved markets across the US. We have a big market to go after, striving to provide the best and most unique HR service in the space, and some of the most loyal and enthusiastic clients behind us. Big Enough to Get the Job Done, Small Enough to Care. Family working environment with the ability to influence executive decision making and help steer the ship. Compensation: Base Salary of $70,000-$85,000 plus commission structure, enabling a potential total earning potential of $105,000-$185,000+ About Alcott HR At Alcott HR, we have a Passion for People and Performance™. We empower leaders to focus on their core business purposes and meaning which enables them to more quickly and efficiently grow their business. Alcott HR provides clients and business owners with customized solutions for running their business, including HR best practices, regulatory compliance, payroll, training and development, employee benefits, risk management support, workers' compensation insurance and employment related administration. We serve a diverse group of successful profit and not for profit businesses across the U.S. Get to know us by visiting ***************** Alcott HR provides equal employment opportunities (EEO) to all employees and applicants for employment without regard to race, color, religion, sex, national origin, age, disability or genetics. In addition to federal law requirements, Alcott HR complies with applicable state and local laws governing nondiscrimination in employment in every location in which the company has facilities.

Job DescriptionBusiness Development - Commercial HVAC (Union Market) Company: Quaker Mechanical Employment Type: Independent Contractor (1099) - Commission OnlyAbout Us Quaker Mechanical is a leading commercial HVAC contractor specializing in union projects. With a reputation for excellence, we deliver top-tier mechanical solutions in the union HVAC marketplace across the Cinnaminson area and beyond. Position Overview We're seeking a driven Business Development professional with a solid background in commercial construction sales within the union HVAC market. This is a 1099, commission- only opportunity designed for self-starting individuals eager to grow their income based on performance. Key Responsibilities Cultivate and maintain relationships with general contractors, developers, and union contacts. Identify and pursue new project opportunities in commercial HVAC. Negotiate and close deals aligned with company capacity and goals. Collaborate with internal teams (estimating, operations) to transition new projects smoothly. Provide market insights and strategic growth recommendations. Qualifications 2+ years of experience in commercial construction sales, with a focus on union HVAC. Familiarity with the union HVAC landscape and strong industry contacts. Excellent negotiation, communication, and relationship-building skills. Ability to work independently in a commission-based, 1099 role. Compensation Structure (Commission + Stipends) This role offers uncapped earning potential through a tiered commission on gross profit, plus fixed monthly stipends: 0.5% on $0 - $100,000 Contract amount 1.0% on $101,000 - $500,000 Contract amount 1.5% on $501,000 - $750,000 Contract amount 2.0% on $751,000 and above Contract amount $100/month cell phone stipend $300/month auto stipend

Job Description Our client, a growing, privately owned, Light Industrial Staffing services, in New jersey is looking for a Business Development professional to join their team. This role will focus on bringing in new Light Industrial business in the Southern, NJ, Philly, and Northern Delaware market. Most of this position is field based and Friday's are spent in their Southern New Jersey office Responsibilities include; Prospecting new business by phone, email, social media, and in-person Meeting new clients within an assigned territory (with no internal competition) nts. Using Salesforce to document sales activity, meetings, follow ups etc. Contract negotiations. Reach agreed upon monthly sales targets. YOU might be the right person if YOU have: Previous light industrial temporary staffing sales experience or recruiting experience. Outside B2B sales experience selling into the light industrial space Strong closing abilities. Strong sense or urgency Attention to detail. Our client offers a competitive base salary, commission, car allowance, phone and benefits Master Search Solutions is a direct hire recruiting firm that specializes in the New Jersey marketplace. We have nearly 30 years of experience connecting top talent with leading businesses. We are committed to (and celebrate) diversity, equity, and inclusion.

CORE is currently seeking a hardworking and experienced Title Insurance Sales Representative. Join one of Philadelphia's fastest growing title companies and most successful title team! Whether you have a well-established client base or need help taking your business to the next level, we want to meet. Increase overall resale and refinance market share in the New Jersey and Pennsylvania market by building strong relationships with REALTORS, mortgage brokers and loan originators, banks, credit unions. Team player who acts as the liaison between the inside office staff and clients in the field. Must be confident in making cold calls, prospecting for leads, as well as maintaining current customer's needs. Strong social media presence is a plus. Develop and initiate new sales and marketing ideas. Actively pursue office presentations with office brokers and staff Knowledge of real estate business is extremely helpful. Consistently increase business and revenues Candidate must possess the following: Strong work ethic. Must provide own reliable transportation. Superior time management skills OTHER REQUIREMENTS: Attending outside functions both during the day and some evenings Excellent interpersonal communication skills (both written and verbal) Ability to effectively present information one-on-one and in group settings Maintain a professional appearance and providing a positive company image EDUCATION: Minimum High School or equivalent (required) Degree in Sales and Marketing (preferred) EXPERIENCE: 2-5 years of successful sales experience in the Real Estate industry Salary is commensurate with experience Job Type: Full-time

Job DescriptionSalary: Gras Lawn, a commercial landscape company, is seeking an experienced Landscape Business Developer for the Philadelphia Market. Your main responsibility is developing business with potential new customers, building and maintaining trusted relationships with key decision-makers, understanding their challenges, and creating value solutions. Your role also involves effectively identifying opportunities, gathering valuable intelligence, creating customer-centric proposals, collaborating with team members, meeting specific activity targets, and closing deals. The Business Developer focuses on strengthening Gras Lawns market presence and driving profitable growth. This position plays a key role in meeting long-term strategic objectives by fostering important customer relationships, identifying business opportunities, negotiating and closing deals, and maintaining a comprehensive understanding of the current market landscape. Identifyandunderstandthechallengesofprospectiveclientsanddevelopsolutions. Provideaccurateforecastsforsales,deliverables,andkeyperformanceindicators(KPIs). Achievesalesgoalswhilehavingtheabilitytoworkindependently. Usesalestechniquestofindnewcustomersandbuildlong-termbusinessrelationships.Also,focusonmarketingandpricingstrategies. Conductphoneprospecting,salespresentations,virtualdemonstrations,andcontractnegotiationswithminimalsupervision. Identifycustomerneedsandapplysolution-basedsellingtechniquestodemonstratethevalueof GrasLawnsserviceseffectively. Buildandnurturerelationshipswithpotentialandcurrentclients. Planyourdailyactivitiesandaimtomeetspecificperformancebenchmarkstoclosebusinessdealssuccessfully. ConsistentlyandreliablylogactivitiesintheCRM. Workeffectivelyinafast-pacedenvironmentwhilemaintainingastrongsenseofurgency. Communicateproactivelywithallclients,prospects,andcolleagues. SkillsRequired: ExtensiveexperienceintheCommercialLandscapeIndustry Proventrackrecordofsalesgoalattainmentandpipelinemanagement 3-5yearsofexperienceinB2Bsalesatmid-to-seniorlevels. Localknowledgeandcontactsinoneormoremarketsegments Proficientwithcomputerprograms,including AspireandaCRMtool Highlycompetitive,positive,andresults-driven Exceptionalmultitasker. Excellentoralandwrittencommunicationabilities,strongpresentationskills,andprofessionalexperiencewithsocialmedia. Passionate,organized,andresourcefulindividualwithoutstandinglisteningandinterpersonalskills. Highly organized, self-motivated, and hardworking, with effective time management capabilities. Easilyadaptabletonewsituations. Salary commensurate with experience. Youwillberesponsiblefor: TheBusinessDeveloperoverseesthesalespipelinefromtheprospectingstagetoclosingandisaccountablefortheentiresalescycle,includingsnowsalesincertainregions.Additionally,the BusinessDeveloperworksincollaborationwithpartnersacrossoperations,finance,marketing,andotherdepartmentstoeffectivelyrespondtobidsandachievesalesgoals. Salary commensurate with experience.

Mount Laurel, New Jersey, United States of America **Hours:** 40 **Pay Details:** $86,840 - $139,360 USD TD is committed to providing fair and equitable compensation opportunities to all colleagues. Growth opportunities and skill development are defining features of the colleague experience at TD. Our compensation policies and practices have been designed to allow colleagues to progress through the salary range over time as they progress in their role. The base pay actually offered may vary based upon the candidate's skills and experience, job-related knowledge, geographic location, and other specific business and organizational needs. As a candidate, you are encouraged to ask compensation related questions and have an open dialogue with your recruiter who can provide you more specific details for this role. **Line of Business:** Business Management, Strategy & Support **Job Description:** The Control Remediation Quality Assurance Business Management Specialist will have appropriate Audit or Risk and Controls subject matter expertise to assist each Remediation owner through the end-to-end Remediation lifecycle. This role is an integral part of the Review & Challenge tollgate panels at both the workstream and full concern level, ensuring effective remediation, leading to successful Internal Audit validation. This role engages with stakeholders to provide ongoing support as well as receive feedback on R&C coordinator team efforts to identify opportunities to enhance the end-to-end remediation program. **Depth & Scope:** + Works autonomously and accountable for acting as a lead within a specialized business management function and may provide work direction to others + Provides seasoned specialized knowledge, advice and/or guidance to various stakeholders and team members + Scopes of role may have enterprise impact + Focuses on short to medium - term issues (e.g. 6-12 months) + Undertakes and completes a variety of complex projects and initiatives requiring specialist knowledge and/or the integration of cross functional processes within own area of expertise + Oversees and/or independently performs tasks from end to end **Education & Experience:** + Undergraduate degree + 7+ years relevant experience **Preferred Qualifications:** + 7+ years of Audit/Risk and Controls experience is preferred + Subject matter expertise within the banking industry + Highly organized, with demonstrated ability to develop, analyze, improve and apply complex policies, processes and procedures + Solid understanding of Regulatory environment and its role in the banking industry + Effective negotiation and influencing skills + Advanced communication and presentation skills + Works independently as an individual contributor to provide end-to-end support for remediation; including feedback on control of environment + Works with all lines of defense on remediation efforts **Customer Accountabilities:** + Contributes to the strategic direction of the business management function and play a key role in the development and implementation of strategies in support of the overall business strategy + Plans, leads / manages and/or oversees a diverse set of work activities requiring alignment across multiple areas + Leads / manages the integrated implementation of policies / processes / procedures / changes in across multiple functional areas + Provides direction and/or input to complex, wide ranging enterprise or cross-function / business projects/initiatives as a subject matter expert and where necessary participates in identifying, designing and testing solutions and supporting the implementation + Facilitates key discussions and provides thought leadership to executive audience (output is roadmap and/or strategic plan/ deliverables/frameworks/ short to long term goals etc.) + Leads partner to management / leadership and respective teams for area of specialization with industry, external and internal, enterprise and business awareness; recognizing and anticipating emerging trends and; identifying issues and opportunities and recommending action to senior management + Works effectively with multiple teams across a broad spectrum of initiatives and functional domains, influencing others as needed **Shareholder Accountabilities:** + Adheres to enterprise frameworks and methodologies that relate to business management activities for own area + Actively manages relationships with corporate and/or control functions and ensure alignment with enterprise and/or regulatory requirements + Keeps abreast of emerging issues, trends, and evolving regulatory requirements and assess potential impacts to the Bank + Assesses / identifies key issues and escalate to appropriate levels and relevant stakeholders where required + Maintains a culture of risk management and control, supported by effective processes and sound infrastructure an in alignment with risk appetite + Ensures business operations are in compliance with applicable internal and external requirements (e.g. financial controls, segregation of duties, transaction approvals, and physical control of assets). + Participates in cross-functional / enterprise initiatives as a subject matter expert helping to identify risk / provide guidance for complex situations + Leads relevant governance meetings or committees and related deliverables / outcomes + Leads / facilitates and/or implements action/remediation plans to address performance/risk/governance issues **Employee/Team Accountabilities:** + Provides thought leadership and/or industry knowledge for own area of expertise + Supports a positive work environment that promotes service to the business, quality, innovation and teamwork and ensure timely communication of issues/ points of interest + Identifies and recommends opportunities to enhance productivity, effectiveness and operational efficiency + Works effectively as a team, supporting other members of the team in achieving business objectives and providing client services + Participates in knowledge transfer within the team and business units **Who We Are:** TD is one of the world's leading global financial institutions and is the fifth largest bank in North America by branches/stores. Every day, we deliver legendary customer experiences to over 27 million households and businesses in Canada, the United States and around the world. More than 95,000 TD colleagues bring their skills, talent, and creativity to the Bank, those we serve, and the economies we support. We are guided by our vision to Be the Better Bank and our purpose to enrich the lives of our customers, communities and colleagues. TD is deeply committed to being a leader in customer experience, that is why we believe that all colleagues, no matter where they work, are customer facing. As we build our business and deliver on our strategy, we are innovating to enhance the customer experience and build capabilities to shape the future of banking. Whether you've got years of banking experience or are just starting your career in financial services, we can help you realize your potential. Through regular leadership and development conversations to mentorship and training programs, we're here to support you towards your goals. As an organization, we keep growing - and so will you. **Our Total Rewards Package** Our Total Rewards package reflects the investments we make in our colleagues to help them and their families achieve their financial, physical and mental well-being goals. Total Rewards at TD includes base salary and variable compensation/incentive awards (e.g., eligibility for cash and/or equity incentive awards, generally through participation in an incentive plan) and several other key plans such as health and well-being benefits, savings and retirement programs, paid time off (including Vacation PTO, Flex PTO, and Holiday PTO), banking benefits and discounts, career development, and reward and recognition. Learn more (*************************************** **Additional Information:** We're delighted that you're considering building a career with TD. Through regular development conversations, training programs, and a competitive benefits plan, we're committed to providing the support our colleagues need to thrive both at work and at home. **Colleague Development** If you're interested in a specific career path or are looking to build certain skills, we want to help you succeed. You'll have regular career, development, and performance conversations with your manager, as well as access to an online learning platform and a variety of mentoring programs to help you unlock future opportunities. Whether you have a passion for helping customers and want to expand your experience, or you want to coach and inspire your colleagues, there are many different career paths within our organization at TD - and we're committed to helping you identify opportunities that support your goals. **Training & Onboarding** We will provide training and onboarding sessions to ensure that you've got everything you need to succeed in your new role. **Interview Process** We'll reach out to candidates of interest to schedule an interview. We do our best to communicate outcomes to all applicants by email or phone call. **Accommodation** TD Bank is an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, age, disability, status as a protected veteran or any other characteristic protected under applicable federal, state, or local law. If you are an applicant with a disability and need accommodations to complete the application process, please email TD Bank US Workplace Accommodations Program at *************** . Include your full name, best way to reach you and the accommodation needed to assist you with the applicant process. Federal law prohibits job discrimination based on race, color, sex, sexual orientation, gender identity, national origin, religion, age, equal pay, disability and genetic information.

We are a business development and sales company that executes promotional campaigns to drive sales on behalf of our brand partners. Our partners rely on us to increase revenue, generate positive experiences, and raise customer satisfaction ratings. The primary responsibility of the Business Development Associate is to create business and sales opportunities through direct-to-consumer campaigns. They will actively engage and deliver compelling product presentations in an effort to increase revenue and generate sales. Additionally, as the Business Development Associate, you will have the opportunity to take on leadership and managerial responsibilities upon successfully achieving KPIs set by senior management. If you're a passionate self-starter with an interest in business development, growth, and client relations, we look forward to hearing from you! What You'll Do as a Business Development Associate: Prospect potential customers/business opportunities by vetting warm leads Build and maintain relationships with customers, stakeholders, clients, and fellow staff Work closely with the sales and customer service teams to maintain KPIs at high levels Identify areas of improvement and communicate feedback professionally and effectively Monitor sales and customer service pipelines, track progress, and hold regular meetings with appropriate staff Examine profit and loss statements to ensure company funds are utilized appropriately Convert sales leads into valuable long-term customers by utilizing stellar customer service What We're Looking For in a Business Development Associate: A bachelor's degree or equivalent, preferred 1+ years of experience in business development and/or management, preferred Ambitious self-starters with a passion for client relations and business development Critical thinking skills, the ability to come up with creative solutions on your feet A team player who's able to communicate effectively with fellow staff and customers Familiarity with sales, lead generation, customer service, or business development practices is a plus Growth-oriented individuals looking to grow with a company long-term Why Join Us? Travel opportunities- all transportation & accommodation expenses covered! Internal growth opportunities- we only promote from within our company! Comprehensive business development guidance & mentorship Commission bonuses are available with uncapped earning potential Competitive weekly pay

**Women's Health Business Specialist - Newark, DE** Developing innovative therapies is one of the most challenging, most essential, and personally rewarding fields in science. This is the most exciting time to be a part of Astellas, a company with a uniquely collaborative and patient-focused culture. There's something special about working at Astellas. It's reflected in our focus on the people we serve, the way we treat each other and the results we achieve together as a company. Astellas is announcing a Women's Health Business Specialist opportunity in the **Newark, DE** area. **The Role** Achieve territory sales goals by promoting Astellas products and services to physicians and other medical personnel within assigned geography. Educate customers on the use, characteristics, advantages, indicated treatments and all other developments related to promoted products. Professionally represent Astellas in the field and ensure high levels of visibility and customer satisfaction in territory. Maintain effective communication and relationships with key external and internal customers. Flexible grade level based on candidate background and skillset. **Primary Responsibilities** + Effectively promote and educate targeted physicians/HCPs on the use of Astellas' products through one-on-one meetings and group presentations, company-approved promotional speaker programs, and other company-approved means. + Work 5 days in the field each week, supported by office time as needed for call planning, customer follow-up, preparing presentations, making appointments, report generation, etc. + Ensure solid performance levels of call and field productivity. Meet Call Plan expectations and achieve territory product sales goals while adhering to all APUS-defined ethical sales practices, Compliance guidelines, and required promotional regulations + Execute company-approved Product Marketing plans and territory/regional business plan activities + Support targeted customers using company-approved resources, sales materials, and promotional activities/programs/initiatives as identified by Sales Management + Coordinate promotional efforts with peers across franchises and co-promotion alliance partners as appropriate. This includes appropriately managing/maintaining all company equipment and company-approved promotional materials (e.g., sales materials, company literature, product samples, etc.) according to defined company Compliance guidelines + Achieve territory product sales goals while adhering to all APUS-defined ethical sales practices, Compliance guidelines, and required promotional regulations + Ensure territory sales strategy execution using annual territory business plan, regional business plan, and call activity reports + Accurately report/submit sales call activities, territory expenses and written reports and within deadline as defined by Astellas or the Regional Sales Manager + Attend all company-sponsored sales and medical meetings as directed by company management. + Additional duties as needed **Quantitative Dimensions** This position is responsible for achieving both territory product sales goals and territory sales activity goals through company defined metrics. **Organizational Context** It is important for individuals in this position to actively pursue continuous learning and professional sales development on effective sales and communication techniques and product/therapeutic area knowledge. This position: + Is a customer facing sales position + Reports to Regional Sales manager + Maintains territory responsible for managing Astellas' products + Partners with counterparts, teammates, and cross functional colleagues as appropriate + Balance's territory and regional work and projects, while maintaining solid level of sales performance + Exhibits strong level of skill in competencies + Demonstrates sales influence within territory and at times within region **Qualifications** **Required** + BA/BS degree + 2+ years pharmaceutical selling experience + Strong knowledge of sales processes and pharmaceutical products and industry + Solid communication, facilitation, and presentation skills + Proactive; can do approach + Demonstrates problem solving ability; analytical; business acumen + Solid motivational and persuasion skills + Demonstrates team orientation and leadership + Proven record of sustained high sales performance and achievement + Proficient in MS Office Suite + Ability to travel at least up to 50% of the time; and at times overnight travel + Valid driver's license in good standing **Preferred** + Advanced degree or continued education + Knowledge of promoting specialty products **Salary Range:** $72,485 - $141,900 (Final compensation will be determined based on a variety of factors, including but not limited to skills, experience and organizational equity considerations) **Benefits:** + Medical, Dental and Vision Insurance + Generous Paid Time Off options, including Vacation and Sick time, plus national holidays including year-end shut down + 401(k) match and annual company contribution + Company paid life insurance + Annual Corporate Bonus and Quarterly Sales Incentive for eligible positions + Long Term Incentive Plan for eligible positions + Company-paid fleet vehicle for eligible positions + Referral bonus program This is intended to describe the general nature and level of work which may be performed by the person assigned to this position. This job description is not intended to be construed as an exhaustive list of all responsibilities, duties, and skills required of this position. Employees holding this position may perform other job-related duties in the course of their performance of this position **\#LI-LK** _All qualified applicants will receive consideration for employment without regard to race, sex, color, religion, sexual orientation, gender identity, national origin, protected veteran status, or on the basis of disability._ Category Sales Astellas is committed to equality of opportunity in all aspects of employment. EOE including Disability/Protected Veterans