Business development director jobs in Toms River, NJ - 498 jobs

At Navista, our mission is to empower community oncology practices to deliver patient-centered cancer care. Navista, a Cardinal Health company, is an oncology practice alliance co-created with oncologists and practice leaders that offers advanced support services and technology to help practices remain independent and thrive. True to our name, our experienced team is passionate about helping oncology practices navigate the future. This is an executive leader responsible for leading the strategic growth and development initiatives for Navista. Key responsibilities include expanding the network's reach, fostering partnerships, expanding service line offerings, and driving overall strategy to support the organization's ability to deliver exceptional patient care. The VP of Business Development will be a seasoned leader and advisor, with proven experience partnering with clinicians in oncology and across multiple therapeutic areas. They will be responsible for setting sales targets and marketing goals. Their job duties include developing production and sales goals, driving the overall monetary health of the organization, obtaining new contracts, and overseeing a sales executive. This role reports to the SVP/GM of Navista. **Responsibilities** + Oversee the commercial operations & strategy division, to develop and execute comprehensive strategic development plans aligned with the networks mission and growth objectives + Identify opportunities for expansion, partnerships and programmatic enhancements to advance the networks presence and impact + Identify and foster relationships with healthcare providers, research institutions and other key stakeholders + Define strategic pipeline including opportunities for growth and new revenue streams, such as service line expansion, entering new markets or developing innovative programs + Collaborates with marketing and communications on the development and implementation of branding and marketing strategies to enhance the networks visibility & reputation through development of compelling messaging, promotional materials, and public relations initiatives. + Partners with Corporate Development on identifying and evaluating potential new practices and partnership + Develops and maintains strong relationships with key stakeholders, including internal sales team to drive the overall oncology strategy + Responsible for sales operations and leading and developing a team + Negotiates contracts and agreements + Proven track record of leading Teams responsible for growth through acquisitions, partnerships, and service line expansion. + Strong understanding of practice management, operations, and healthcare regulations **Qualifications** + Bachelor's degree in business administration, healthcare administration, life sciences, or a related field preferred; advanced degree (MBA, Master's in healthcare administration) preferred + 15+ in an executive strategy & development position, or similar title preferred + Demonstrated abilities for success in strategic development, business development, preferably in the healthcare industry, including identifying and evaluating market opportunities, and developing business plans for expansion & growth + Experience in a Business Development or Growth role with a Managed Services Organization (MSO) or in the specialty community practice space preferred + Excellent communication and presentation skills, with the ability to effectively convey the network's mission and impact with physicians, staff and internal stakeholders + Familiarity with Oncology, Urology, or other specialties, including trends, healthcare regulations, treatment modalities, and research advancements + Strong business acumen and financial background, to ensure efficient allocation of resources and maximize returns on investments + Experience with leading and managing diverse teams, including hiring, training and evaluating performance + Strong analytical and problem-solving abilities + Ability to travel up to 50% **Anticipated salary range** : $166,300 - 255,700 **Bonus eligible** : Yes **Benefits** : Cardinal Health offers a wide variety of benefits and programs to support health and well-being. + Medical, dental and vision coverage + Paid time off plan + Health savings account (HSA) + 401k savings plan + Access to wages before pay day with my FlexPay + Flexible spending accounts (FSAs) + Short- and long-term disability coverage + Work-Life resources + Paid parental leave + Healthy lifestyle programs **Application window anticipated to close** : 1/15/2026 *if interested in opportunity, please submit application as soon as possible. The salary range listed is an estimate. Pay at Cardinal Health is determined by multiple factors including, but not limited to, a candidate's geographical location, relevant education, experience and skills and an evaluation of internal pay equity. _Candidates who are back-to-work, people with disabilities, without a college degree, and Veterans are encouraged to apply._ _Cardinal Health supports an inclusive workplace that values diversity of thought, experience and background. We celebrate the power of our differences to create better solutions for our customers by ensuring employees can be their authentic selves each day. Cardinal Health is an Equal_ _Opportunity/Affirmative_ _Action employer. All qualified applicants will receive consideration for employment without regard to race, religion, color, national origin, ancestry, age, physical or mental disability, sex, sexual orientation, gender identity/expression, pregnancy, veteran status, marital status, creed, status with regard to public assistance, genetic status or any other status protected by federal, state or local law._ _To read and review this privacy notice click_ here (***************************************************************************************************************************

The Exec Director, Strategic BD is responsible for driving Enterprise-level sales growth through global account strategy, strategic partnerships, and long-term client engagement. This role focuses on identifying and securing high-impact opportunities across the biopharmaceutical landscape by navigating complex procurement environments, leading preferred provider pursuits, negotiating master service agreements (MSAs), and orchestrating cross-functional solution development. With a strong understanding of the clinical development lifecycle and deep relationships within the pharmaceutical industry, the Exec Director, Strategic BD partners closely with internal stakeholders across therapeutic strategy, operations, legal, finance, and delivery to create client-centric growth strategies that support Syneos Health's global objectives. Core Responsibilities * Leads global business development efforts across a portfolio of high-value accounts, driving strategic growth and revenue expansion. * Identifies, evaluates, and pursues enterprise-level opportunities, including preferred provider arrangements, MSAs, and strategic alliances. * Creates and maintains multi-year strategic growth plans for key global clients, aligned with Syneos Health's commercial objectives. * Serves as a strategic advisor and trusted partner to client executives by understanding their business priorities, development pipelines, and partnership expectations. * Navigates complex global sourcing and procurement organizations to influence client decision making and streamline contracting processes. * Collaborates cross-functionally with therapeutic leads, operations, delivery, and marketing to co-create compelling, client-tailored solutions. * Leads and coordinates the development of high-impact proposals, RFP responses, and executive presentations. * Maintains up-to-date and accurate records in CRM systems (e.g., Salesforce), including account strategy documentation, contacts, opportunities, and communications. * Represents Syneos Health at key industry events, conferences, and client meetings to enhance brand visibility and cultivate new opportunities. * Monitors market dynamics and competitor activity to inform strategic pursuits and continuously refine account strategies. * Develops and implements an annual sales plan for assigned markets/accounts, including forecasting, objective setting, and quarterly reviews to adjust for evolving needs. * Prioritizes accounts and territory focus using data-informed insights on client opportunity and market potential. * Creates and executes monthly objectives aligned to the sales plan, effectively managing time and resources to achieve targets. * Develops and maintains strategic account plans, proactively identifying client challenges and collaborating with internal teams to deliver solutions. * Builds and nurtures strong relationships with key client stakeholders, including decision-makers and influencers, to expand account value. * Leads the design and execution of tailored, multi-touchpoint sales strategies based on client needs, market dynamics, and strategic goals. * Drives account expansion strategies, including therapeutic alignment, renewals, and next-phase opportunities. * Collaborates with cross-functional teams-such as operations, therapeutic strategy, deal strategy, and delivery-to co-create customized, client-focused solutions. * Maintains up-to-date records of client activity, pipeline, and sales progress within CRM platforms such as Salesforce. * Acts as a client advocate internally, sharing insights on culture, preferences, and priorities to guide proposal development and team alignment. * Educates clients on Syneos Health's differentiated value proposition and evolving service capabilities across clinical and commercial offerings. * Represents Syneos Health at client meetings, industry conferences, and professional events to elevate brand visibility and uncover new opportunities. * Monitors industry trends, competitive landscape, and emerging client needs to continuously refine engagement strategies. * Conducts regular reviews of territory performance and sales pipeline to inform sales planning and forecasting. Qualifications * Bachelor's Degree in a science related field, Graduate Degree preferred * Proven experience in strategic sales, global business development, or client relationship management. * Significant experience in the clinical trial industry, with deep knowledge of the pharmaceutical landscape (required). * Deep understanding of clinical research service lines (e.g., full-service offer, FSP and RWLP) and the full drug development lifecycle. * Demonstrated success in leading preferred provider pursuits and negotiating master service agreements. * Proven ability to build and maintain strategic relationships with mid- to executive-level stakeholders across large, matrixed organizations. * Strong consultative selling skills with the ability to uncover client needs and co-create impactful, tailored solutions. * Excellent communication, presentation, and negotiation skills. * Collaborative and influential, with experience leading cross-functional sales efforts and managing competing priorities with attention to detail. * Highly organized and able to prioritize effectively in a dynamic, fast-paced environment. * Strategic thinker with strong business acumen and data-driven decision-making capability. * Proficient in MS Office Suite, Google Workspace, and CRM tools such as Salesforce. * Willingness to travel at least 60% for client engagements, internal meetings, and industry conferences At Syneos Health, we believe in providing an environment and culture in which Our People can thrive, develop and advance. We reward and recognize our people by providing valuable benefits and a quality-of-life balance. The benefits for this position may include a company car or car allowance, Health benefits to include Medical, Dental and Vision, Company match 401k, eligibility to participate in Employee Stock Purchase Plan, Eligibility to earn commissions/bonus based on company and individual performance, and flexible paid time off (PTO) and sick time. Because certain states and municipalities have regulated paid sick time requirements, eligibility for paid sick time may vary depending on where you work. Syneos complies with all applicable federal, state, and municipal paid sick time requirements. Salary Range: 121,600 - 266,134 The base salary range represents the anticipated low and high of the Syneos Health range for this position. Actual salary will vary based on various factors such as the candidate's qualifications, skills, competencies, and proficiency for the role. TSP Talent Solutions and our customers are affirmative action/equal opportunity employers (Minorities/Females/Veterans/Disabled). # Syneos Health Clinical BD #LI-West

Medidata: Powering Smarter Treatments and Healthier People Medidata, a Dassault Systèmes company, is leading the digital transformation of life sciences, creating hope for millions of people. Medidata helps generate the evidence and insights to help pharmaceutical, biotech, medical device and diagnostics companies, and academic researchers accelerate value, minimize risk, and optimize outcomes. More than one million registered users across 2,000+ customers and partners access the world's most trusted platform for clinical development, commercial, and real-world data. Known for its groundbreaking technological innovations, Medidata has supported more than 30,000 clinical trials and 9 million study participants. Medidata is headquartered in New York City and has offices around the world to meet the needs of its customers. Discover more at **************** and follow us on LinkedIn, Instagram, and X. About the Team: As a Global Client Executive, you will be achieving sales, account growth, and client success objectives at several of our most strategic accounts - including identifying and qualifying platform growth opportunities, and efficiently leveraging resources in order to bring opportunities to a successful conclusion. Responsible for maintaining a high level of customer satisfaction - consistent with Medidata business principles. Responsibilities: * Develop and execute strategic account management plans for assigned accounts * Accomplishment of all revenue and booking targets within assigned territory. * Maintaining and updating account and opportunity data within company systems as directed, including Salesforce.com * Representing Medidata in a manner consistent with company business principles and ethics Qualifications: * Bachelor's degree required * Requires a minimum of 15 years of successful relevant experience, including Medical Device experience * Strong knowledge of life sciences industry, including R&D, Clinical, Quality, Manufacturing, Supply Chain and IT functions * Demonstrated consistent track record of being a trusted advisor within large accounts * Ability to leverage a consultative approach to drive positive outcomes for clients * Demonstrated consistent track record in exceeding sales and related account targets * Ability to gain executive credibility, understand organizational political dynamics and competitive awareness * Demonstrated consistent tenacity and drive to achieve goals * Strong business planning and organizational skills * Strong application software experience * Excellent verbal and written communication skills * Demonstrated success with process approached selling The salary range posted below refers only to positions that will be physically based in New York City. As with all roles, Medidata sets ranges based on a number of factors including function, level, candidate expertise and experience, and geographic location. Pay ranges for candidates in locations other than New York City, may differ based on the local market data in that region. The base salary pay range for this position is $135,000-$155,000. Base pay is one part of the Total Rewards that Medidata provides to compensate and recognize employees for their work. Most sales positions are eligible for a commission on the terms of applicable plan documents, and many of Medidata's non-sales positions are eligible for annual bonuses. Medidata believes that benefits should connect you to the support you need when it matters most and provides best-in-class benefits, including medical, dental, life and disability insurance; a generous pension; and 25+ paid holidays per year. Applications will be accepted on an ongoing basis until the position is filled. #LI- LW1 #LI-Hybrid

Partner Development Manager (Vendor Alliances) SLED About the role Climb is expanding its SLED division, and we're seeking a Partner Development Manager to guide vendor partners into the State, Local Government & Education market. This strategic role blends GTM planning, data-driven insights, and cross-functional leadership to help vendors enter, scale, and thrive in the public sector channel. Reporting to the VP of SLED/Education, you'll manage strategic vendor relationships, build repeatable GTM motions, and deliver operational and analytical support to accelerate vendor penetration and revenue growth What You'll Do * Lead GTM Strategy: Develop and execute SLED-focused go-to-market plans for assigned vendors, aligning with Climb's public sector priorities. * Drive Market Expansion: Build bottom-up business plans using market and performance data to define opportunity size, penetration strategy, and revenue targets. * Enable Vendors: Advise on procurement nuances, reseller dynamics, and channel best practices while delivering actionable insights and competitive assessments. * Own Relationships: Serve as the primary SLED liaison for strategic vendor partners, representing SLED in executive meetings, QBRs, and planning sessions. * Collaborate Across Teams: Partner with sales, vendor management, marketing, operations, and finance to ensure seamless execution of GTM initiatives. * Activate the Channel: Coordinate reseller engagement activities, trainings, and promotional programs to drive adoption and growth. * Measure Success: Set goals, track KPIs, and report on GTM performance to inform strategic decisions. What We're Looking For * 5+ years in alliance management, GTM planning, vendor management, or marketing leadership. * Deep understanding of public sector procurement and reseller/distribution channels. * Proven ability to turn data into actionable strategies and deliver executive-ready plans. * Strong communication and presentation skills with experience leading cross-functional initiatives. * Highly organized, adaptable, and proactive with a knack for building trust-based relationships. * Bachelor's degree in Marketing, Business, or related field; comfortable with moderate travel (~20%). Why Climb? We invest in your growth through training, development, and advancement opportunities. This role is pivotal in shaping vendor success and driving strategic growth in the SLED market. If you're strategic, data-driven, and passionate about enabling partners, this is your opportunity to make an impact. Climb Channel Solutions possess a 'make-it-happen' culture where hard work, creativity and success are visible throughout the company up to our CEO. We offer a competitive salary, benefits package and opportunities for continuous professional growth. Apply Now--We're looking forward to reading your resume! Climb Global Solutions, Inc., and Subsidiaries (the "Company") is an information technology ("IT") channel company providing both distribution and cloud technology solutions through its Climb Channel Solutions ("Climb"), Grey Matter and Climb Global Services operating segments. Climb is a specialty technology distributor focused on emerging data center and cloud-based products, delivering software and hardware to corporate resellers, value added resellers (VARs), consultants and systems integrators globally. Grey Matter US is a value-added reseller of software, hardware and services for U.S. and Canadian corporations, government organizations and academic institutions. Grey Matter is a UK-based software reseller and cloud service provider devoted to helping Developers, ISVs and tech-led companies succeed and focus on what they do best. Climb Global Services is a technical services team of cloud adoption and migration specialists, supporting all aspects of cloud adoption from migration to training and enablement services.

Shape the future of wealth management by driving innovation and growth at J.P. Morgan. Be at the heart of launching strategic initiatives, empowering teams, and making a lasting impact on our clients and organization. Unlock your potential and help set new standards in financial services. As the Business Development Consultant within J.P. Morgan Wealth Management, you are responsible for executing strategic business initiatives and ensuring the successful rollout of new products, services, and processes across the organization. This role acts as a bridge between business development, sales, product, and operations teams, driving project delivery and supporting field adoption to achieve growth objectives. **Job Responsibilities** + Execute the implementation of new business development strategies, products, and services to Financial Advisors and Field Leaders in collaboration with cross-functional teams. + Manage timelines, and deliverables for field execution. + Coordinate and lead training and support for sales and support teams to ensure effective adoption of new technology, practice management and business development supporting an Advisor's practice. + Monitor progress, identify risks, and resolve issues that arise during implementation. + Collect and analyze feedback from field teams and clients to inform continuous improvement. + Foster strong relationships with internal stakeholders and external partners to facilitate successful implementation. **Required qualifications, skills, and capabilities** + Bachelor's degree in Business, Finance, or related field + 7 + years of experience in business development, project management, sales management or implementation roles within financial services. + Proven track record of managing complex projects and cross-functional teams. + Strong organizational, analytical, and problem-solving skills. + Excellent communication, presentation and stakeholder management abilities. + Knowledge of financial products, services, and regulatory requirements. + Experience in coaching Advisors or a sales team + Travel required 50% of the time **Required Licensing** + A valid and active Series 7 license is required or may be obtained within a 60-day condition of employment + If you were registered after October 1, 2018, you must also have a valid and active Securities Industry Essential (SIE) exam + A valid and active Series 66 (63/65), and Life and Health Insurance license must be obtained within 60 days of starting in the role as a condition of employment **Skills** + Executive presentation and communication skills + Change management + Cross-functional collaboration + Data analysis and reporting + Training and facilitation INVESTMENT AND INSURANCE PRODUCTS ARE: NOT FDIC INSURED - NOT INSURED BY ANY FEDERAL GOVERNMENT AGENCY - NOT A DEPOSIT OR OTHER OBLIGATION OF, OR GUARANTEED BY, JPMORGAN CHASE BANK, N.A. OR ANY OF ITS AFFILIATES - SUBJECT TO INVESTMENT RISKS, INCLUDING POSSIBLE LOSS OF THE PRINCIPAL AMOUNT INVESTED Investment products and services are offered through J.P. Morgan Securities LLC (JPMS), a registered broker-dealer and investment advisor, member of FINRA and SIPC. Annuities are made available through Chase Insurance Agency, Inc. (CIA), a licensed insurance agency, doing business as Chase Insurance Agency Services, Inc. in Florida. JPMS, CIA and JPMorgan Chase Bank, N.A. are affiliated companies under the common control of JPMorgan Chase & Co. Products not available in all states. Chase is a leading financial services firm, helping nearly half of America's households and small businesses achieve their financial goals through a broad range of financial products. Our mission is to create engaged, lifelong relationships and put our customers at the heart of everything we do. We also help small businesses, nonprofits and cities grow, delivering solutions to solve all their financial needs. We offer a competitive total rewards package including base salary determined based on the role, experience, skill set and location. Those in eligible roles may receive commission-based pay and/or discretionary incentive compensation, paid in the form of cash and/or forfeitable equity, awarded in recognition of individual achievements and contributions. We also offer a range of benefits and programs to meet employee needs, based on eligibility. These benefits include comprehensive health care coverage, on-site health and wellness centers, a retirement savings plan, backup childcare, tuition reimbursement, mental health support, financial coaching and more. Additional details about total compensation and benefits will be provided during the hiring process. We recognize that our people are our strength and the diverse talents they bring to our global workforce are directly linked to our success. We are an equal opportunity employer and place a high value on diversity and inclusion at our company. We do not discriminate on the basis of any protected attribute, including race, religion, color, national origin, gender, sexual orientation, gender identity, gender expression, age, marital or veteran status, pregnancy or disability, or any other basis protected under applicable law. We also make reasonable accommodations for applicants' and employees' religious practices and beliefs, as well as mental health or physical disability needs. Visit our FAQs for more information about requesting an accommodation. Equal Opportunity Employer/Disability/Veterans **Base Pay/Salary** Cherry Hill, NJ $95,000.00 - $155,000.00 / year

We are looking for a mid-level sales manager (business development manager) that can help us with client acquisition in IT services. Requirement: * Must carry past experience in selling IT/Tech services to clients * Must be able to help us by bringing in US based clients/companies to us that need big data services * 4+ years experience in IT sales * Proven sales figures from the past * Proven strong contacts with IT decision makers at large and medium size companies This position comes with a strong commission structure. Additional Information All your information will be kept confidential according to EEO guidelines.

We seek to fill a Revenue Cycle Director role in the Asbury Park, NJ area. The candidate will be responsible for applying expert knowledge of trend identification, process implementation and improvement, planning, training, and guidance to the RCM Managers. The position includes a generous salary and benefits. (This is not a remote position). Revenue Cycle Director responsibilities include: Providing day-to-day strategic leadership and operational guidance to all RCM departments. Working collaboratively with peers across the group to ensure the smooth, efficient operation of the RCM departments to maximize cash flow. Actively seeks out and implements process improvement opportunities. Ensuring compliance with all applicable state and federal laws and regulations. Place high emphasis on developing an efficient, effective billing model that can sustain or improve financial performance within an evolving landscape. May perform other duties as assigned. Requirements Who Are You? You're someone who wants to influence your own development. You're looking for an opportunity where you can pursue your interests and your passion. Where a job title is not considered the final definition of who you are, but merely the starting point for your future. You also bring the following skills and experience Bachelor's degree required; Master's Degree preferred. Five or more years of experience in Full Cycle RCM (i.e., coding, billing, and collection) with at least three years in a management role. Experience working in a large, multi-location medical practice or Management Service Organization (MSO) environment Experience with Athena Practice management software Experience in all phases of managed care contracting process, including analysis and presentation of financial impact preferred. Ability to communicate clearly and concisely in written and verbal form to leaders, staff, and outside entities. Analytical skills to develop, compile and prepare reports and convey findings as needed. Ability to evaluate workflows and appropriately recommends process improvements. Benefits The position includes a generous salary and benefits. (This is not a remote position).

Legend Biotech is a global biotechnology company dedicated to treating, and one day curing, life-threatening diseases. Headquartered in Somerset, New Jersey, we are developing advanced cell therapies across a diverse array of technology platforms, including autologous and allogenic chimeric antigen receptor T-cell, T-cell receptor (TCR-T), and natural killer (NK) cell-based immunotherapy. From our three R&D sites around the world, we apply these innovative technologies to pursue the discovery of safe, efficacious and cutting-edge therapeutics for patients worldwide. Legend Biotech entered into a global collaboration agreement with Janssen, one of the pharmaceutical companies of Johnson & Johnson, to jointly develop and commercialize ciltacabtagene autolecuel (cilta-cel). Our strategic partnership is designed to combine the strengths and expertise of both companies to advance the promise of an immunotherapy in the treatment of multiple myeloma. Legend Biotech is seeking Manager, Corporate FP&A Business Partner as part of the Finance team based in Somerset, NJ. Role Overview We're looking for a strategic and collaborative FP&A Business Partner to support our business units in planning, forecasting, and performance analysis. This role will serve as a key liaison between Corporate Finance and Business Units Finance leaders, helping translate financial data into actionable insights and compelling narratives. Key Responsibilities Partner with business units finance teams to support budget and forecast submissions Coordinate calendar and deliverables for planning cycles (budget, forecast, long-range plan) Develop clear, insightful financial commentaries for leadership reviews Prepare monthly and quarterly business review presentations for senior leadership Analyze financial performance and variances across departments and regions Act as a strategic advisor to business units on financial planning and decision-making Translate complex financial data into actionable insights for non-financial stakeholders Contribute to strategic initiatives by modeling scenarios and evaluating financial impact Support ad hoc analysis and special projects for executive stakeholders Support BD modelling and financial evaluation of strategic and R&D opportunities. Develop detailed financial models, conduct NPV and scenario analysis and prepare recommendations to inform go-no-go decisions. Requirements Bachelor's degree in Finance, Accounting, Economics, or related field 5+ years of experience in FP&A or financial business partnering Strong understanding of financial statements and business drivers Excellent communication and presentation skills Strong proficiency in financial planning tools (e.g., Anaplan, OneStream, SAP Analytics) Proficiency in Excel, PowerPoint, and financial planning tools Ability to manage multiple priorities and deliver high-quality insights under tight deadlines #Li-LB1 #Li-Hybrid The base pay range below is what Legend Biotech USA Inc. reasonably expects to offer at the time of posting. Actual compensation may vary based on experience, skills, qualifications, and geographic location. The company reserves the right to modify this range as needed and in accordance with applicable laws. Performance-based bonus and/or equity is available to employees in eligible roles. The anticipated base pay range is: $107,482 - $141,070 USD Benefits Benefits include medical, dental, and vision insurance as well as a 401(k) retirement plan with a company match that vests fully on day one. We offer eight (8) weeks of paid parental leave after just three (3) months of employment, and a paid time off policy that includes vacation time, personal time, sick time, floating holidays, and eleven (11) company holidays. Additional benefits include flexible spending and health savings accounts, life and AD&D insurance, short- and long-term disability coverage, legal assistance, and supplemental plans such as pet, critical illness, accident, and hospital indemnity insurance. We also provide commuter benefits, family planning and care resources, well-being initiatives, and peer-to-peer recognition programs; demonstrating our ongoing commitment to building a culture where our people feel empowered, supported, and inspired to do their best work. Please note: These benefits are offered exclusively to permanent full-time employees. Contract employees are not eligible for benefits through Legend Biotech. EEO Statement It is the policy of Legend Biotech to provide equal employment opportunities without regard to actual or perceived race, color, creed, religion, national origin, ancestry, citizenship status, age, sex or gender (including pregnancy, childbirth, related medical conditions and lactation), gender identity or gender expression (including transgender status), sexual orientation, marital status, military service and veteran status, disability, genetic information, or any other protected characteristic under applicable federal, state or local laws or ordinances. Employment is at-will and may be terminated at any time with or without cause or notice by the employee or the company. Legend may adjust base salary or other discretionary compensation at any time based on individual, team, performance, or market conditions. For information related to our privacy policy, please review: Legend Biotech Privacy Policy.

Venture Solar is hiring a Business Development Consultant. A Solar Sales Consultant is not a lead generation role where you will be asked to knock on doors or cold call. We are seeking experienced sales representatives that are closers with a track record of success in sales and are looking for the right environment to be successful. Our appointment setting teams will schedule qualified appointments on your calendar for you to meet with the homeowner(s) and close with the best combination of products, services, and track record in the industry. We view the sales process in solar to be educational and we realize that it is an emotional decision for people to make the switch, so we focus on making sure that our customers understand not just how solar works, but also where the money is coming from to help pay for their project so that it doesn't seem "too good to be true". What you'll bring: Sales experience - Required Outside sales (In home sales) - preferred Solar experience - welcomed Willingness to learn Benefits: Base salary plus commission 401k match program Health, Dental, and Vision insurance Paid Time Off Compensation: Base salary + uncapped commission (OTE $100,000-$250,000)

Job Description Are you a dynamic and driven sales professional who thrives on forging new connections and nurturing client relationships? Are you passionate about making a positive impact in people's lives? Do you crave a career that offers both flexibility and autonomy? If you answered "yes" to any of these questions, then RestoreCore has the perfect opportunity for you! About RestoreCore: Imagine working for a family-owned disaster restoration business with over 45 years of experience and a legacy of trust. RestoreCore, with thriving locations across PA, NJ, DE, MD, and the DC-Metro area, is on an exciting journey of growth. We don't just clean up after disasters; we restore homes, businesses, and lives! We're a trusted partner, offering support before, during, and after catastrophes strike, and at the forefront of building these invaluable partnerships is our dedicated Business Development team. Why Join Us: Competitive compensation package including a salary based on your experience and abilities, commission, and KPI-related bonuses. A role that lets you make a real impact by helping individuals and businesses in their time of need. Opportunities for personal and professional growth in a supportive and collaborative work environment. Flexibility and autonomy in your daily work, allowing you to thrive in your role. What You'll Do: Present and sell RestoreCore restoration services in the Central/North Jersey market. Identify and nurture new and existing client relationships in diverse industry verticals, such as commercial property management, multifamily rental housing, senior living, healthcare facilities, hospitality, government, and educational institutions. Meet with prospective and current clients, ranging from on-site staff to C-Suite executives, at various locations and events. Participate in marketing events like tradeshows, happy hours, golf outings, sporting events, etc. Actively engage in industry trade associations and networking groups. Coordinate client training sessions and other opportunities to position RestoreCore as an industry expert and partner. Utilize our company-provided CRM system to log client interactions, manage the opportunities pipeline, and facilitate client forecasting using our proven seven-step sales process. Collaborate closely with the RestoreCore production team to support project sales and ensure client satisfaction from start to finish. Qualifications: Extensive B2B sales experience, preferably within the restoration or property management industry. Established and proven relationships with commercial clients and/or property management professionals. Strong understanding and knowledge of the property management industry, insurance claims industry, and/or the restoration industry. Proven customer service skills in high-stress, fast-paced environments. A minimum of 5 years of outside sales experience. The ability to set and achieve sales targets effectively. Excellent verbal and written communication skills. RestoreCore is an Equal Opportunity employer dedicated to providing fair employment opportunities to all qualified applicants, regardless of race, color, religion, sex, sexual orientation, gender identity or expression, national origin, disability, or protected veteran status. Our commitment is to create an inclusive and respectful work environment for everyone. Please Note: We kindly request that third-party agencies refrain from reaching out regarding this position. We are focused on building direct connections with prospective candidates and prefer to handle the recruitment process in-house. Thank you for your cooperation.

CORE is currently seeking a hardworking and experienced Title Insurance Sales Representative. Join one of South Jersey's fastest growing title companies and most successful title team! Whether you have a well-established client base or need help taking your business to the next level, we want to meet. Increase overall resale and refinance market share in the New Jersey and Pennsylvania market by building strong relationships with REALTORS, mortgage brokers and loan originators, banks, credit unions. Team player who acts as the liaison between the inside office staff and clients in the field. Must be confident in making cold calls, prospecting for leads, as well as maintaining current customer's needs. Strong social media presence is a plus. Develop and initiate new sales and marketing ideas. Actively pursue office presentations with office brokers and staff Knowledge of real estate business is extremely helpful. Consistently increase business and revenues Candidate must possess the following: Strong work ethic. Must provide own reliable transportation. Superior time management skills OTHER REQUIREMENTS: Attending outside functions both during the day and some evenings Excellent interpersonal communication skills (both written and verbal) Ability to effectively present information one-on-one and in group settings Maintain a professional appearance and providing a positive company image EDUCATION: Minimum High School or equivalent (required) Degree in Sales and Marketing (preferred) EXPERIENCE: 2-5 years of successful sales experience in the Real Estate industry Salary is commensurate with experience Job Type: Full-time

Job DescriptionSalary: Gras Lawn, a commercial landscape company, is seeking an experienced Landscape Business Developer for the South Jersey Market. Your main responsibility is developing business with potential new customers, building and maintaining trusted relationships with key decision-makers, understanding their challenges, and creating value solutions. Your role also involves effectively identifying opportunities, gathering valuable intelligence, creating customer-centric proposals, collaborating with team members, meeting specific activity targets, and closing deals. The Business Developer focuses on strengthening Gras Lawns market presence and driving profitable growth. This position plays a key role in meeting long-term strategic objectives by fostering important customer relationships, identifying business opportunities, negotiating and closing deals, and maintaining a comprehensive understanding of the current market landscape. Identifyandunderstandthechallengesofprospectiveclientsanddevelopsolutions. Provideaccurateforecastsforsales,deliverables,andkeyperformanceindicators(KPIs). Achievesalesgoalswhilehavingtheabilitytoworkindependently. Usesalestechniquestofindnewcustomersandbuildlong-termbusinessrelationships.Also,focusonmarketingandpricingstrategies. Conductphoneprospecting,salespresentations,virtualdemonstrations,andcontractnegotiationswithminimalsupervision. Identifycustomerneedsandapplysolution-basedsellingtechniquestodemonstratethevalueof GrasLawnsserviceseffectively. Buildandnurturerelationshipswithpotentialandcurrentclients. Planyourdailyactivitiesandaimtomeetspecificperformancebenchmarkstoclosebusinessdealssuccessfully. ConsistentlyandreliablylogactivitiesintheCRM. Workeffectivelyinafast-pacedenvironmentwhilemaintainingastrongsenseofurgency. Communicateproactivelywithallclients,prospects,andcolleagues. SkillsRequired: ExtensiveexperienceintheCommercialLandscapeIndustry Proventrackrecordofsalesgoalattainmentandpipelinemanagement 3-5yearsofexperienceinB2Bsalesatmid-to-seniorlevels. Localknowledgeandcontactsinoneormoremarketsegments Proficientwithcomputerprograms,including AspireandaCRMtool Highlycompetitive,positive,andresults-driven Exceptionalmultitasker. Excellentoralandwrittencommunicationabilities,strongpresentationskills,andprofessionalexperiencewithsocialmedia. Passionate,organized,andresourcefulindividualwithoutstandinglisteningandinterpersonalskills. Highly organized, self-motivated, and hardworking, with effective time management capabilities. Easilyadaptabletonewsituations. Salary commensurate with experience. Youwillberesponsiblefor: TheBusinessDeveloperoverseesthesalespipelinefromtheprospectingstagetoclosingandisaccountablefortheentiresalescycle,includingsnowsalesincertainregions.Additionally,the BusinessDeveloperworksincollaborationwithpartnersacrossoperations,finance,marketing,andotherdepartmentstoeffectivelyrespondtobidsandachievesalesgoals. Salary commensurate with experience.

Welcome to Distinctive Living, we're seeking a Director of Sales and Marketing (Full-Time) for our Mira Vie Manalapan, community! Here at Distinctive Living , we want our people to realize their full potential. We're passionate about personal and professional growth and will do everything we can to help you flourish. We deeply care about our team-members and partners and strive to provide a culture where people feel valued and inspired. Benefits when choosing a career with Distinctive: Medical, Dental and Vision benefits Paid Time Off 401k Retirement Plan & Life Insurance Team Member Assistance Program The Director of Sales and Marketing maintains and/or improves upon the occupancy level and revenue production of the community in accordance with marketing and business plans to include managing the sales process and completing all activities required for a sale. Represents the community and increases awareness through participation in outside events. Assists management with resident retention. Develops and executes marketing plans and achieve community occupancy goals. Responsibilities: Maintains and/or improves upon the occupancy level of the community in accordance with the marketing and business plans. Utilizes established sales processes, systems, and forms for sales to perform job duties, track information, compile data and reports, and achieve desired community occupancy goals. Markets community services and programs to prospective residents, their family members, and/or advisors in the decision-making process and adapts marketing, presentation, and education based on the specific needs of the prospective resident. Coordinates and completes all activities needed for a sale and converts deposits to move-ins. Based on Director's assessment of need, visits the prospect's home, health care providers, or other locations to conduct initial assessments or marketing presentations as appropriate. Ensures all paperwork is completed prior to move-in. Keeps management and other key associates abreast of the status of all prospective move-ins. Tracks and records pre-residency steps to facilitate communication. Interface with local sources including legal and financial professionals, senior organizations, appropriate special interest groups, hospital discharge planners, skilled nursing facilities, retirement communities, clergy, medical insurance providers, and other local community contacts that are not part of the business development coordinator/director referral contacts. Manages the business development activities noted above in the absence of business development associates. Develops and maintains relationships with and generates leads through residents, family, and professional referral sources on a weekly basis. Provides information and conducts presentations about community services and programs, market advantages, availability, and other relevant information to meet the needs of prospective referral sources and community groups. Director will have autonomy to determine the frequency, content and audience of such marketing presentations. Effectively manages community inventory and looks for opportunities for increasing revenue and creating other revenue streams. Represents the community and increases awareness through participation in outside events, professional groups, and community involvement in the local market. Uses relevant community knowledge and research to plan, coordinate, and implement monthly prospect and/or referral source activities and events consistent with goals of management and the community marketing plan. Follows up and executes sales process with all leads from events. Assists management with resident retention through new resident welcome events, resident referral programs, outside community visits to current hospitalized residents, and other programs as the Director deems appropriate and as is consistent with the marketing plan. Develops and executes marketing plans and achieve community occupancy goals. Researches and provides recommendations for content and delivery of brochures, flyers, press releases and other forms of media that promote community services. Monitors conversion ratios regarding sales performance and business development calls to direct referral sources and collects and analyzes data to prepare weekly and monthly reports. Provides frequent sales performance issue information to management and makes recommendations to management regarding broader marketing and retention strategies. Maintains working knowledge of lead management systems and uses them to maximize sales effectiveness. Inputs all sales and marketing activities in a timely manner and according to systems standards. Performs other duties as assigned or determined by the Director to be appropriate. Must effectively perform independently and under only general supervision. Required Skills and Experience: 5+ years outside sales experience required Experience working in a service-related industry desired, experience working in hospitality or health care sales experience is a plus. Must have the ability to travel locally to attend functions, network within the community, create and implement events. 4 year Bachelor's Degree in Marketing, Business or related field from an accredited University preferred. The ideal candidate will be a team player that enjoys challenges, is professional, upbeat, and encourages others to succeed. Apply today to learn why Distinctive Living is a certified Great Place to Work!

We have an exciting Sales role within our Health Research business with Ovid Technologies as a Senior Sales and Business Development Representative **Ovid Guidelines AI, an agentic GenAI solution** . This solution supports end-to-end guideline lifecycle management by uniting researchers, expert panels, and review boards through a shared, auditable environment for coordinating projects and capturing key evidence, deliberations, and decisions over time. The Senior Sales and Business Development Representative for **Ovid Guidelines** is responsible for building and maintaining effective long-term relationships and a high level of satisfaction with decision makers and influencers. You will be responsible for developing and implementing a comprehensive sales plan that includes new sales strategies for large societies and organizations publishing clinical guidelines. You will collaborate closely with colleagues from the Ovid Sales Team to establish new sales of Ovid Guidelines AI. Your role is pivotal in driving the growth and success of our company. You will be focused on generating new business for a new solution and will be at the forefront of expanding our client base by forging valuable partnerships with Medical Societies and Health Organizations nationally. **RESPONSIBILITIES** + **New Deal Generation:** Proactively seek out and identify potential clients and opportunities, with a primary focus on closing new multi-year deals. + **Lead Qualification:** Evaluate and qualify leads to ensure alignment with our target market and business objectives. + **Sales Strategy** : Develop and execute strategies to approach and engage prospective clients, tailoring your approach to meet their unique needs. + **Pitch and Presentation:** Conduct compelling sales presentations and demonstrations to showcase the value and benefits of our offerings. + **Negotiation and Closing:** Handle negotiations with prospective clients, addressing any objections, and guiding them through the sales process to secure new contracts. + **Pipeline Management:** Maintain and manage a robust pipeline of new business opportunities, tracking progress and reporting on key metrics. + **Proven Sales Experience:** Demonstrated success in sales roles, with a focus on acquiring new business and closing complex new business deals. + **Strong Negotiation Skills:** Ability to effectively negotiate terms and close deals while maintaining a positive client experience. + **Understanding of Society/Organization sales:** Role requires experience and proven history of success negotiating with and navigating with this market segment + **Strategic Mindset:** Skilled in developing and executing strategies to attract and convert new clients. + **Excellent Communication:** Exceptional verbal and written communication skills, with the ability to articulate complex solutions clearly and persuasively to a broad range of key stakeholders. + **Self-Motivated:** Highly driven and proactive, with a strong work ethic and a passion for achieving and exceeding sales targets. + **Experience with SAAS Sales in Healthcare:** Understanding of navigating budget, IT and procurement for new products in healthcare **QUALIFICATIONS** **Education:** bachelor's degree or equivalent experience **Experience:** + 5+ years field sales experience + Value-based selling skills + Challenger sales methodology preferred + Develop an understanding of each society's area of discipline + Software or Cloud sales experience + Healthcare/Medical Market + Understanding of how guidelines are created + Importance of standards of care - value of guidelines + How medical evidence is fine-tuned into guidelines for the medical users + Publishing, Information, or Health Technology industry preferred + Medical society contacts experience - understanding society goals, serving their membership + Sales experience to Societies - Navigating society decision-making + Knowledge about CRM Applications (e.g., Salesforce) **TRAVEL:** 20% \#LI-Remote **Our Interview Practices** _To maintain a fair and genuine hiring process, we kindly ask that all candidates participate in interviews without the assistance of AI tools or external prompts. Our interview process is designed to assess your individual skills, experiences, and communication style. We value authenticity and want to ensure we're getting to know you-not a digital assistant. To help maintain this integrity, we ask to remove virtual backgrounds and include in-person interviews in our hiring process. Please note that use of AI-generated responses or third-party support during interviews will be grounds for disqualification from the recruitment process._ _Applicants may be required to appear onsite at a Wolters Kluwer office as part of the recruitment process._ **Compensation:** $71,300.00 - $124,500.00 USD This role is eligible for Commission. _Compensation range listed is based on primary location of the position. Actual base salary offer is influenced by a wide array of factors including but not limited to skills, experience and actual hiring location. Your recruiter can share more information about the specific offer for the job location during the hiring process._ **Additional Information** **:** Wolters Kluwer offers a wide variety of competitive benefits and programs to help meet your needs and balance your work and personal life, including but not limited to: Medical, Dental, & Vision Plans, 401(k), FSA/HSA, Commuter Benefits, Tuition Assistance Plan, Vacation and Sick Time, and Paid Parental Leave. Full details of our benefits are available upon request. EQUAL EMPLOYMENT OPPORTUNITY Wolters Kluwer U. S. Corporation and all of its subsidiaries, divisions and customer/business units is an Equal Opportunity / Affirmative Action employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, disability, or protected veteran status.

BraveView has been engaged by a growing $14mm Commercial Landscape company in the Piscataway, NJ market to recruit and hire an experienced Business Developer to join their organization. Ideally, this person should target the Northern part of the NJ market and look for opportunities that fit our company's criteria. Title: Business Developer Category: Full Time, Salary Salary: $75,000 - $85,000 based on skill & experience plus sales commissions. Job Summary: The Commercial Landscape Business Developer is responsible for driving revenue growth by identifying, pursuing, and securing commercial landscape maintenance contracts. This role focuses on building and maintaining strong client relationships, generating leads, and closing sales for landscape maintenance services. The ideal candidate is a proactive, results-driven professional with strong sales skills and knowledge of the landscaping industry. Key Responsibilities: Lead Generation: Identify and target potential commercial clients, such as property managers, HOAs, corporate campuses, retail centers, and municipalities, through cold calling, networking, referrals, and industry events. Client Relationship Management: Build and maintain long-term relationships with clients, understanding their needs and providing tailored landscape maintenance solutions. Sales Process: Develop and present proposals, negotiate contract terms, and close deals for recurring maintenance contracts and additional services. Market Research: Stay informed about industry trends, competitor offerings, and local market opportunities to position the company competitively. Site Assessments: Conduct site visits to evaluate client properties, assess landscaping needs, and provide accurate cost estimates and service plans. Collaboration: Work closely with operations and account management teams to ensure seamless service delivery and client satisfaction post-sale. CRM Management: Maintain accurate records of sales activities, client interactions, and pipeline progress using CRM software. Revenue Goals: Meet or exceed quarterly and annual sales targets for maintenance contracts and upsell opportunities. Qualifications: Bachelor's degree in business, horticulture, landscape management, or related field (preferred but not required). 3+ years of B2B sales experience, preferably in landscaping, facilities management, or a related industry. Strong understanding of commercial landscaping services, including maintenance, irrigation, and seasonal care. Proven track record of meeting or exceeding sales quotas. Excellent communication, negotiation, and presentation skills. Ability to build rapport and trust with diverse clients, including property managers, HOA boards and corporate decision-makers. Proficiency in CRM software and Microsoft Office. Valid driver's license and ability to travel to client sites. Preferred Skills: Knowledge of local plants, climate, and landscaping best practices. Experience in creating and delivering compelling proposals and bids. Familiarity with commercial property management or real estate sectors. Compensation & Benefits: Competitive base salary plus commission. Health, dental, and vision insurance. Company vehicle or mileage reimbursement. Paid time off and holidays. 401k Opportunities for professional development and career growth. If you are qualified and interested, please respond to this job posting by sending us a copy of your resume. #ZR

Job DescriptionDescription: About Us: Approved Fire Protection Co. is New Jersey's oldest family-owned, full-service fire protection and safety equipment company. Our services include fire extinguishers, alarm systems, suppression systems, SCBA, gas detection, carbon dioxide, oxygen, sprinkler systems, access control, CCTV, and so much more. Approved Fire Protection's mission is to supply life safety and security products and services to the industrial, commercial, pharmaceutical, and municipal companies in New Jersey and near surrounding areas. Job Summary: We are seeking a driven, high-energy New Business Sales Representative to aggressively grow our portable gas meter, SCBA, & PPE divisions. This role is focused on pure hunting and outbound prospecting, building new relationships, driving first-time appointments, and converting opportunities into revenue. The ideal candidate thrives on activity, embraces cold outreach, and excels at opening new doors through phone calls, LinkedIn messaging, email campaigns, networking, and in-person site visits.This individual will represent our full line of SCBA, portable gas meters, and PPE products and services-while educating customers on compliance, safety, and risk reduction. Success in this role is measured by daily/weekly outbound activity, KPI targets, pipeline growth, and consistent quota attainment. If you are competitive, motivated by new business generation, and excel in fast-paced sales environments, this position offers strong earning potential, autonomy, and the opportunity to make a meaningful impact on customer safety and security. Benefits: Medical, Dental, Vision, HSA 401k with company contributions Life Insurance Long term disability Long Term Care Insurance Summer Hours Program Profit Sharing Mileage Reimbursement PTO Salary: $55k - $65K base salary plus uncapped commissions, car package, bonus, profit sharing Requirements: Prior experience in the fire protection industry or PPE sales is preferred. Prior outside sales experience is a MUST. Able to travel to customer sites throughout your territory. Excellent communication, negotiation, and interpersonal skills via email, text message, a phone. Valid driver's license and excellent driving record. Must pass a background check and pre-employment drug screen. Excellent customer service skills. Continuing education as training/ seminars arises Must be able to work Monday through Friday 7:20 am - 4:20 PM Language: Must be able to read, write in English

Come and be part of Global Glass packaging solution company!! We are adding to our Sales and Marketing team. We offer great salary and benefits. Sales Strategy Development: Develop and execute effective sales strategies to drive growth in the West Coast market segments of food, pharma, beverage and Distribution sales. Market Research: Conduct comprehensive market research to identify customer needs, industry trends, and competitor analysis to develop and implement sales and marketing strategies. Customer Relationship Management: Build and maintain strong relationships with key customers, understand their requirements, and provide tailored solutions to meet their needs. New Business Development: Identify and pursue new business opportunities within the food, pharma, beverage and Distribution market segment, including prospecting, lead generation, and conversion. Product Positioning and Promotion: Collaborate with the marketing team to develop compelling product positioning and messaging and execute promotional campaigns to increase brand awareness and drive sales. Sales Forecasting and Reporting: Analyze sales data, track performance metrics, and provide regular reports to management on sales forecasts, market trends, and competitive analysis. Sales Training and Support: Provide training and support to the sales team when necessary on product knowledge, sales techniques, and market insights to enhance the knowledge of the team Analyze, Develop and regularly update the West Coast Strategy for Distribution, Food, Pharma & Beverage Markets Recommend Alternate Products Based on Cost, Availability or Specifications. Provide Monthly Reports consisting of Account Sales Summaries, Aged Inventory, Sales Projections, Account Receivables and other Pertinent Sales Information. Take a keen interest to learn the technical aspect of glass manufacturing and decoration Travel and make Presentations to customers. Willing to make cold calls Take an interest in the business of the assigned customer

Medidata follows a hybrid office policy in which employees who are hired for an in-person position are expected to work on site a certain number of days per week in accordance with Company policy. About our Company: Medidata is powering smarter treatments and healthier people through digital solutions to support clinical trials. Celebrating 25 years of ground-breaking technological innovation across more than 36,000 trials and 11 million patients, Medidata offers industry-leading expertise, analytics-powered insights, and one of the largest clinical trial data sets in the industry. More than 1 million users trust Medidata's seamless, end-to-end platform to improve patient experiences, accelerate clinical breakthroughs, and bring therapies to market faster. Discover more at ***************** About the Team: Our client Executive achieves booking, revenue, & profit goals within their assigned account territories, including identifying sales opportunities through daily prospecting, qualifying opportunities, and efficiently applying Medidata resources to bring opportunities to successful conclusion. Client Executives build consultative, long-term relationships with their customers to create tailored, cost-effective solutions. Personal involvement in customer relationships and high levels of customer satisfaction are essential to remain consistent with Medidata business principals. You will report to the director of mid-market sales Responsibilities: * Daily outbound calling through established campaigns to prospective customers / prospects * Consistent accomplishment of booking, revenue, and profit targets within assigned territory * Accomplishment of daily, weekly, quarterly productivity metrics * Establish and grow relationships with "C-Level" decision makers within customer / prospect organizations. Maintain well-coordinated internal relationships with important decision makers * Educate prospects on Medidata's value proposition and solution portfolio * Develop external relationships with Medidata partners * Develop and achieve sales plan as it relates to developing a new book of business / newly assigned territory * Directly responsible for closing sales transactions with clients and prospects * Partner with Market Development Specialists to close mid-market lead opportunities * Coordinate resources within sales and other departments * Maintain and update sales plans, account and opportunity data within company systems as directed, including Salesforce. * Build customer loyalty, provide an excellent experience, achieve retention rates * Weekly / monthly / quarterly Pipeline forecasting * Complete administrative work * Schedule and conduct regular face-to-face client meetings. * Ability to support travel to client and internal meetings and conferences. Qualifications: * Experience balancing multiple sales opportunities * Experience establishing communication and engagement with prospects * Experience working in a web-based environment * Business experience following a clear process for outreach using different methods * Experience researching and generating leads and technical skills * Minimum 3 years of previous tech / software sales experience * Demonstrated consistent track record in exceeding sales targets * Demonstrated success with process approached selling * Application software sales experience * Bachelor's degree in the Life Sciences, Business or Computer Science preferred, or equivalent relevant sales experience As with all roles, Medidata sets ranges based on a number of factors including function, level, candidate expertise and experience, and geographic location. * The salary range for positions that will be physically based in the NYC Metro Area is $101,750 to $135,000. * The salary range for positions that will be physically based in the California Bay Area is $108,000.00 to 135,000.00 * The salary range for positions that will be physically based in the Boston Metro Area is $103,000.00 to 135,000.00 * The salary range for positions that will be physically based in Texas or Ohio is $103,000.00 to 135,000.00 * The salary range for positions that will be physically based in all other locations within the United States is $103,000.00 to 135,000.00 Base pay is one part of the Total Rewards that Medidata provides to compensate and recognize employees for their work. Most sales positions are eligible for a commission on the terms of applicable plan documents, and many of Medidata's non-sales positions are eligible for annual bonuses. Medidata believes that benefits should connect you to the support you need when it matters most and provides best-in-class benefits, including medical, dental, life and disability insurance; 401(k) matching; flexible paid time off; and 10 paid holidays per year. Equal Employment Opportunity: In order to provide equal employment and advancement opportunities to all individuals, employment decisions at Medidata are based on merit, qualifications and abilities. Medidata is committed to a policy of non-discrimination and equal opportunity for all employees and qualified applicants without regard to race, color, religion, gender, sex (including pregnancy, childbirth or medical or common conditions related to pregnancy or childbirth), sexual orientation, gender identity, gender expression, marital status, familial status, national origin, ancestry, age, disability, veteran status, military service, application for military service, genetic information, receipt of free medical care, or any other characteristic protected under applicable law. Medidata will make reasonable accommodations for qualified individuals with known disabilities, in accordance with applicable law. Applications will be accepted on an ongoing basis until the position is filled. #LI-LW1 #LI-Hybrid

Job Description Partner Development Manager (Vendor Alliances) SLED About the role Climb is expanding its SLED division, and we're seeking a Partner Development Manager to guide vendor partners into the State, Local Government & Education market. This strategic role blends GTM planning, data-driven insights, and cross-functional leadership to help vendors enter, scale, and thrive in the public sector channel. Reporting to the VP of SLED/Education, you'll manage strategic vendor relationships, build repeatable GTM motions, and deliver operational and analytical support to accelerate vendor penetration and revenue growth What You'll Do • Lead GTM Strategy: Develop and execute SLED-focused go-to-market plans for assigned vendors, aligning with Climb's public sector priorities. • Drive Market Expansion: Build bottom-up business plans using market and performance data to define opportunity size, penetration strategy, and revenue targets. • Enable Vendors: Advise on procurement nuances, reseller dynamics, and channel best practices while delivering actionable insights and competitive assessments. • Own Relationships: Serve as the primary SLED liaison for strategic vendor partners, representing SLED in executive meetings, QBRs, and planning sessions. • Collaborate Across Teams: Partner with sales, vendor management, marketing, operations, and finance to ensure seamless execution of GTM initiatives. • Activate the Channel: Coordinate reseller engagement activities, trainings, and promotional programs to drive adoption and growth. • Measure Success: Set goals, track KPIs, and report on GTM performance to inform strategic decisions. What We're Looking For • 5+ years in alliance management, GTM planning, vendor management, or marketing leadership. • Deep understanding of public sector procurement and reseller/distribution channels. • Proven ability to turn data into actionable strategies and deliver executive-ready plans. • Strong communication and presentation skills with experience leading cross-functional initiatives. • Highly organized, adaptable, and proactive with a knack for building trust-based relationships. • Bachelor's degree in Marketing, Business, or related field; comfortable with moderate travel (~20%). Why Climb? We invest in your growth through training, development, and advancement opportunities. This role is pivotal in shaping vendor success and driving strategic growth in the SLED market. If you're strategic, data-driven, and passionate about enabling partners, this is your opportunity to make an impact. Climb Channel Solutions possess a 'make-it-happen' culture where hard work, creativity and success are visible throughout the company up to our CEO. We offer a competitive salary, benefits package and opportunities for continuous professional growth. Apply Now--We're looking forward to reading your resume! Climb Global Solutions, Inc., and Subsidiaries (the “Company”) is an information technology (“IT”) channel company providing both distribution and cloud technology solutions through its Climb Channel Solutions (“Climb”), Grey Matter and Climb Global Services operating segments. Climb is a specialty technology distributor focused on emerging data center and cloud-based products, delivering software and hardware to corporate resellers, value added resellers (VARs), consultants and systems integrators globally. Grey Matter US is a value-added reseller of software, hardware and services for U.S. and Canadian corporations, government organizations and academic institutions. Grey Matter is a UK-based software reseller and cloud service provider devoted to helping Developers, ISVs and tech-led companies succeed and focus on what they do best. Climb Global Services is a technical services team of cloud adoption and migration specialists, supporting all aspects of cloud adoption from migration to training and enablement services.