Business development manager jobs in Bristol, PA - 1,449 jobs

Workforce Solutions Account Manager With a focus on skill development, real-world job experience, and trauma-informed care, Hopeworks propels young adults into long-term living-wage careers that put them on the path to healing and financial stability. It starts with self-paced, paid technical training in front-end web development, Geographic Information Systems (GIS), data visualization, and revenue cycle management, which are high-demand skills that companies need. To provide a real-world experience, Hopeworks runs three social enterprises focused on web design, revenue cycle management and Geographic Information Systems (GIS). Our businesses provide technology solutions that help clients not only achieve their goals, but also train and employ young adults in high-demand, high-wage careers. While gaining experience through our paid internships, they are also learning professional development skills that help them stand out in the competitive job market. In the last 12 months, our social enterprises paid over $1.63M in wages to our participants. Technical training is important. Even more important, however, is helping our young adults develop the social and emotional skills to not just get high-wage jobs, but keep them. Throughout their training, young adults experience a unique combination of career readiness coaching, academic success support, and a strong community committed to building resilience that puts them on the path to healing and financial stability. On average, over 99% of young adults (aged 17-26) entering Hopeworks are unemployed, making less than $400 annually. Young adults completing the Hopeworks program make, on average, over $43,000 annually, with over 90% 12-month retention rate in their jobs. That is the Hopeworks difference. Position and Responsibilities Hopeworks has successfully developed partnerships with dozens of companies, placing Hopeworks young adults successfully in a wide range of IT and other positions that give those young adults a living wage, transforming their lives and the lives of their families. Placing one, two, even three students at a time has shown Hopeworks -- and our young adults -- the transformative power of living wage-wage employment. To truly change the equation, however, Hopeworks has to do more. Hopeworks must not only develop partnerships to provide more opportunities for young adults, but we must also develop practices and partnerships to make sure those opportunities are welcoming environments for our young people that prioritize not just economic opportunity but equity as well. The mission of the Workforce Solutions Account Manager is to grow Hopeworks employment opportunities through relationship development with employment partners to ultimately create more opportunities for young adults working to change their lives. The Workforce Solutions will develop and maintain relationships with key industry partners throughout the region, helping industry partners fill key entry-level needs and building scalable pathways to employment that can help our young people earn the living wage jobs they need to transform their lives. At the same time, Workforce Solutions will act as a key feedback loop for Hopeworks staff, sharing key industry trends and needs with the Hopeworks team to make sure Hopeworks programming is relevant and meeting industry demands. A successful candidate for this role will use their communication skills to cultivate strong relationships with employers, from first contact through initial placement, and manage the relationship to make sure that employers are delighted by the work of their new employees, which will increase the demand for our young people. They will also make sure that Hopeworks young people are placed in environments that continue to foster their growth and development. Specifically, the Workforce Solutions will focus on: Contact and build relationships with partner employers who have positions that would be a good fit for our young people Build long-term trusting relationships with employers, managing the relationships to make sure employers are delighted by their hires from Hopeworks and always ready to offer more opportunities to Hopeworks young people year after year, including regularly scheduled visits to employment sites Where appropriate, build and manage high-performing customized training pathways with partner employers Proactively seek new employment opportunities and partnerships with our current partners. Proactively seek new employment opportunities in the market Assist in developing and maintaining a calendar of activities to highlight the work and abilities of Hopeworks young people. Work collaboratively with the Site Directors and the Career Programming team to identify, prepare, and place Hopeworks young adults in positions in industry. Assist with alumni support and job placement Additional Responsibilities: Manage recruitment and talent acquisition activities, with a focus on early-career talent and workforce development programs, ensuring effective candidate placement and pipeline development. Build, maintain, and grow employer and client relationships, supporting high-volume hiring needs and sustaining long-term, partnership-driven collaborations. Source, screen, and assess candidates to ensure strong alignment between candidate skills and the employer. Maintain accurate and up-to-date employer and candidate records using CRM platforms (e.g., Salesforce), tracking outreach, engagement, and placement progress. Lead the creation of large-scale, multi-year partnerships with employers, industry associations, and workforce boards to expand pathways for Hopeworks young adults into living-wage careers. Partner with employers to increase awareness and adoption of trauma-informed practices in the workplace, ensuring environments are inclusive and supportive of Hopeworks young adults. Continuously monitor regional and national labor market trends to identify new and emerging career pathways, aligning Hopeworks training and programming with high-demand industries. Collaborate with educational institutions, government agencies, and workforce coalitions to build ecosystem-level solutions for equitable career access. Network to secure opportunities tied to workforce initiatives and employer partnerships. Regularly report on outcomes (placements, wages, retention, advancement) and create compelling narratives that showcase employer and participant success stories to stakeholders, funders, and the community. Ensure employer partners demonstrate measurable commitments to diversity, equity, and inclusion, advocating for systemic change in hiring and retention practices. At essence, the perfect candidate: Is action-oriented and not satisfied until they have exceeded the goal Is detail-oriented, organized, and is able to set priorities and work independently Is goal-oriented and tracks and measures progress. Has strong writing and editing skills. Has strong experience in workforce development and understands how to translate workforce training practice into effective employees Is a natural coach and mentor, with exceptional skills in building, developing, and maintaining relationships in the corporate and for-profit world Has strong customer service skills, working to ensure that employment partners are delighted with the quality of their new employees, and proactively seeks input and feedback from employers. A few other qualities we're looking for include: Open to training in a trauma-informed care approach, which may require shifting previous workforce patterns and perspectives to adapt to a trauma-informed methodology A natural supporter - eager to jump in and help out wherever it's needed. Key Performance Indicators: Number of individuals placed at employment partners Average starting wage 12-month retention Number of young adults promoted/increasing wages within the first 12 months This is not an exhaustive list of all functions that the employee may be required to perform, and the employee may be required to perform additional functions. Additionally, the company reserves the right to revise the job description at any time. The employee must be able to perform the essential functions of the position satisfactorily, and, if requested, reasonable accommodations may be made to enable employees with disabilities to perform the essential functions of their job, absent undue hardship.

Title: Technical Product Manager IV Type: Contract Our direct client is seeking a Technical Product Manager IV for omnichannel campaigns. You will be responsible for driving new and innovative discovery features and capabilities that drive results for business partners around the world. This role requires end-to-end product management skills with a track record of success working across multiple teams and delivering features. You will be responsible for enhancing and optimizing our Search and Browse APIs and services, day-to-day scrum team product ownership, writing user stories / epics, and owning the strategy / prioritization for the platform team's roadmap. This job is an individual contributor role that does not have direct responsibility for supervision or performance management of staff. Key Accountabilities: Articulate features that deliver the best content discovery, search, and personalization experiences in entertainment platforms. Drive decision making by utilizing feature metrics, a/b testing, prototyping, and production iterations. Take ownership and accountability of large complex features and take them from discovery through to delivery and beyond. Collaborate closely with the rest of the organization as well as Delivery, Architecture, Hardware, Legal, UX, Design, and Development teams globally to manage the product life cycle and bring ideas to life at the API & platform level. Define quality epics and user stories to drive engineering work. Perform competitive analysis and conduct market research. Exhibit regular, consistent and punctual attendance. Must be able to work nights and weekends, variable schedule(s) and overtime as necessary. Other duties and responsibilities as assigned. Required Skills: Proven experience in Product Management, preferably related to platform APIs and services in the discovery space. An established background in leading large-scale projects across markets, multiple technical platforms, or a range of systems. Expertise working with large amounts of data and self-serving on analytical tools. A passion for high quality customer and partner experiences and a genuine desire to convert complex problems into simple solutions. Excellent communication skills with the ability to engage and influence colleagues and partners at all levels and across multiple business areas to drive collaboration and alignment.

JOB TITLE: Oncology Account Manager DATE PREPARED: January 8, 2026 This position provides a unique opportunity for an experienced sales professional to be part of AVEO's first national sales force to promote FOTIVDA (tivozanib) for renal cell carcinoma (RCC). This role will report to the Regional Business Director and is field based. We are looking for individuals who share the importance of science-based selling, supported by a strong foundation of business analytics. The OAM will also possess a deep knowledge of the oral drug space, as well as background in later line oncology and or hematology malignancy. A solid understanding of the oncology therapeutic area is essential, with a preference for experience in RCC or GU Oncology. Demonstrated sales success and compassion for patients is required. PRINCIPAL DUTIES: · The OAM will promote safe and effective use of FOTIVDA (tivozanib) within the labeled indication (RCC) and in accordance with company training and policies · Responsible for individual/territory sales performance and goal attainment · Understand the Oncology/RCC environment; have in-depth knowledge of disease-state, local drivers, treatment and referral patterns, etc. · Develop strong relationships with key customers practicing in your geography · Prepare and implement a comprehensive business plan for territory · Exercise sound judgment and ensure integrity and compliance with company policies in all activities and communications · Foster AVEO core values and behaviors REQUIRED QUALIFICATIONS/EXPERIENCE (BASIC QUALIFICATIONS): · BS in Business or Science; 5 - 10 years sales experience in pharmaceutical/biotechnology industry · Demonstrated understanding of oncology therapeutic area, products and marketplace strongly preferred · Proven track record that demonstrates top sales accomplishments · Demonstrated ability to understand and communicate technical clinical material clearly and effectively · Ability to develop critical relationships with physicians, nurses and ancillary staff within academic hospitals, clinics, and private practice facilities · Possesses a strong work ethic, ability to develop priorities and manage time appropriately. · Works with all members of a team effectively · Integrates innovative ideas in order to accomplish corporate and individual objectives · Ability to travel and valid driver's license in good standing required About AVEO AVEO is a commercial-stage, oncology-focused biopharmaceutical company committed to delivering medicines that provide a better life for patients with cancer. AVEO currently markets FOTIVDA (tivozanib) in the U.S. for the treatment of adult patients with relapsed or refractory renal cell carcinoma (RCC) following two or more prior systemic therapies. AVEO continues to develop FOTIVDA in immuno-oncology combinations in RCC and other indications, and has several other investigational programs in clinical development. AVEO is committed to creating an environment of diversity, equity and inclusion to diversify representation within the Company. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, disability, or status as a protected veteran.

Our client provides one-stop solutions for next-generation drug development, supporting the global biomedical community from target identification to IND application. Leveraging proprietary gene-editing technology and innovative platforms, they offer fully human antibody discovery, featuring a library of over 1M sequences targeting nearly 1,000 antigens for global partnerships. Technical teams also deliver an extensive portfolio of products and services, including drug-targeted humanized models, comprehensive preclinical pharmacology services, and custom gene-editing solutions. Responsibilities: Master the science and business skills in the above-mentioned fields. Actively reach out to prospective customers, explore business opportunities, manage negotiations and secure contracts. Attend trade shows/relevant conferences. Support the Marketing Team in branding and building awareness in the marketplace. Requirements: Ph.D. in the bioscience field Strong interest to learn advances in biopharmaceutical science and business Enjoy networking with top scientists from biotech and biopharma companies Proven track record of revenue generation is a plus Excellent written and oral communication skills Willingness to travel (i.e., customer meetings, conferences/vendor shows

Biocytogen is a fast-growing biotech company with broad cutting-edge technologies. You will have the best opportunity to learn and utilize the science and business in the fields of immuno-oncology, animal model gene engineering, preclinical pharmacology, etc. The biggest advantage of working in Biocytogen is that your career will have the best combination of biopharmaceutical science and applications, and you will grow with Biocytogen with confidence and strength. Job Responsibilities Master the science and business skills in the above-mentioned fields. Actively reach out to prospective customers, explore business opportunities, manage negotiations and secure contracts. Attend trade shows/relevant conferences. Support the Marketing Team in branding and building awareness in the marketplace. Requirements Ph.D. in the bioscience field Strong interest to learn advances in biopharmaceutical science and business Enjoy networking with top scientists from biotech and biopharma companies Proven track record of revenue generation is a plus Excellent written and oral communication skills Willingness to travel (i.e., customer meetings, conferences/vendor shows Benefits Medical Insurance Dental Insurance Vision Insurance Health Reimbursement Accounts Life and AD&D Insurance Short & Long Term Disability Insurance 401K with Company Match Paid Time Off Paid Sick Days & Holidays BIOCYTOGEN is an Equal Opportunity Employer. Employment opportunities at BIOCYTOGEN BOSTON CORP are based upon one's qualifications and capabilities to perform the essential functions of a particular job. All employment opportunities are provided without regard to race, color religion, sex, national origin, ancestry, age, sexual orientation, gender identity and expression, veteran status, military status, disability, mental illness, genetic information, or any other characteristic protected by law. This Equal Employment Opportunity policy governs all aspects of employment, including, but not limited to, recruitment, hiring, selection, job assignment, promotions, transfers, compensation, discipline, termination, layoff, access to benefits and training, and all other conditions and privileges of employment.

SourcePro Search has a fantasic opportunity for a Regional Business Development Director with our client, a large and well respected national home health agency. This newly created role will support business development strategy for our client's long-term care facilities (2-4) in PA to ensure that all referral sources are maintained at the highest level. This role offers a high base, bonus potential and excellent benefits as well as growth potential. Some travel required and base location is flexible. Relocation assistance may be offered. This role requires a Bachelor's Degree and at least 4 years of business development experience in a healthcare setting.****************************

About Us: BW Design Group is a fully integrated architecture, engineering, construction, system integration, and consulting firm committed to helping our clients realize their most critical goals from Strategy to Commercialization. As the only firm born from a manufacturing technology company to become an independent and fully integrated firm, we combine deep domain expertise in the manufacturing environment with an approach that is built to serve the dynamic needs of our clients. Rooted in our distinct culture of Truly Human Leadership, we cultivate the leaders who will define tomorrow and partner with our clients in the food & beverage, life sciences, industrial, and advanced technology industries to build the future of manufacturing and technology. Barry-Wehmiller is a diversified global supplier of engineering consulting and manufacturing technology for the packaging, corrugating, sheeting and paper-converting industries. By blending people-centric leadership with disciplined operational strategies and purpose-driven growth, Barry-Wehmiller has become a $3 billion organization with nearly 12,000 team members united by a common belief: to use the power of business to build a better world. Job Description: Who You'll Work With You will join one of our 45 offices in the US, be part of a committed team of over 1500 professionals, and work in teams and directly with our clients doing work that is shaping the world around us. You will be welcomed into a rapidly growing business and team and empowered to make an impact. You will be valued, cared for, and challenged on your path to becoming a world-class professional consultant and surrounded by leaders who are committed to creating an environment that enables you to realize your own success and fulfillment. When you join BW Design Group as a Director, you are joining a team that will challenge you and position you for growth. In this role, you will work with a team of industry experts to help the world's leading companies solve their most difficult problems. You will join our Architecture + Engineering + Construction (AEC) Business and partner with seasoned leaders, technical specialists, and subject matter experts to deliver the highest quality solutions to our clients with consistency and accuracy. Role Overview We are seeking a Director, Client Development (Food & Beverage Manufacturing - Design Build/EPC) to build, secure, and execute large-scale capital programs ($100M+), with direct accountability for bookings, commercial strategy, and delivery outcomes. This client-facing growth leadership role blends strategic client alignment with deep technical expertise to expand multi-project initiatives across processing, packaging, utilities, and facility modernization-including hygienic design, cold chain, and regulated food manufacturing environments-in both brownfield and greenfield settings.Operating outside traditional utilization expectations (e.g., billable hours), the role is measured by bookings, margin-aware account growth, delivery performance, and long-term client value-empowering you to focus on high-impact client strategy, pursuit leadership, and capital alignment in an entrepreneurial environment. Dedicated preconstruction, engineering, and construction teams support the role, ensuring technical depth and delivery leadership partnership complement your accountability in client development. Success in this role is defined by secured bookings, profitable delivery of multi-project capital programs, and sustained executive-level client relationships. What You'll Do Own bookings targets, pricing strategy, and commercial positioning, developing opportunities into secured design-build (DB) and engineer-procure-construct (EPC) initiatives supporting food and beverage processing, packaging, utilities, and distribution facilities-leveraging your technical insights to achieve outcomes. Engage client executive stakeholders across Engineering, Operations, Supply Chain, Quality, Finance, and Environmental, Health, and Safety (EHS) to align capital investment with growth, reliability, Food Safety Modernization Act (FSMA)/Hazard Analysis and Critical Control Points (HACCP) compliance, and speed-to-market objectives. Lead pursuit strategy and executive presentations; negotiate commercial terms, delivery approach, pricing, and risk allocation with direct accountability for contractual outcomes, drawing on technical expertise to build client trust. Lead internal subject matter experts (SMEs) across process, architecture/engineering (A/E), preconstruction, construction, and controls to deliver integrated DB/EPC solutions. Participate in go/no-go reviews, pipeline governance, forecasting, and customer relationship management (CRM) discipline to support predictable growth and backlog health. Serve as executive sponsor through execution and closeout, remaining accountable for client satisfaction, commercial performance, and long-term account profitability. What You'll Bring 15+ years leading and delivering capital programs for manufacturing clients in a design-build, EPC, or integrated A/E/C environment-particularly within food, beverage, CPG, or other regulated production environments-with personal responsibility for securing work, pricing, and delivery execution. Deep understanding of food manufacturing operations, including people and material flows, hygienic zoning, adjacency planning, reliability constraints, and operational readiness across processing and utility systems, applied to inform client alignments and de-risking strategies. Experience leading large, multidisciplinary delivery teams with authority over scope, cost, schedule, and margin. This role requires ownership of commercial outcomes and delivery risk within a DB/EPC model, using technical expertise to secure and execute high-value contracts. Use industry experience and technical knowledge in delivery strategy development and cost/schedule de-risking, including preconstruction, constructability, phasing, shutdown/tie-in planning, and risk management-all to support client pursuits and margin-aware growth. Food & Beverage manufacturing experience strongly preferred; Consumer Packaged Goods (CPG) or life sciences/pharma experience transferable where candidates have delivered regulated, capital-intensive manufacturing facilities. Experience working in quality-driven and regulated environments; Good Manufacturing Practice (GMP)/current GMP (cGMP) and HACCP exposure a plus. Executive-level communication skills with the ability to influence and align technical and non-technical stakeholders. Willingness to travel for client engagement, site walkdowns, and industry events. BS or MS in Engineering, Architecture, Construction Management, or related field. Professional Engineer (PE) preferred but not required; Master of Business Administration (MBA) and/or Project Management Professional (PMP) a plus. Our culture and commitment to our people is what sets us apart. We foster an environment of mutual respect, integrity, and unconditional interest in the individual and collective success of our professionals. Our model and entrepreneurial mindset offer a rewarding, challenging, and highly flexible path. As a Director, you will build a meaningful and fulfilling career with the support of professional development resources and mentorships including our First Year Experience program, Individual Development Plans, and Career Path resources and tools. You will be surrounded by exceptional talent who will support your development as both a world-class engineer and a highly effective leader.Feel like you're on the path to becoming a Director but you're not quite there yet? We'd love to connect with you to see if we can take you from where you are today and grow you into a BW Design Group Consultant. At Barry-Wehmiller we recognize that people come with a wealth of experience and talent beyond just the technical requirements of a job. If your experience is close to what you see listed here, please still consider applying. We know that our differences often can bring about innovation, excellence and meaningful work-therefore, people from all backgrounds are encouraged to apply to our positions. Please let us know if you require reasonable accommodations during the interview process. Barry-Wehmiller is an equal opportunity employer. M/F/D/V This organization uses E-Verify. Applicants may be subject to pre-employment screening which may include drug screening, reference checks, employment verifications, background screening and/or skills assessments. Company: Design Group

The CMP Partner Development Manager is responsible for driving new business opportunities with CMP partners, prioritizing proactive outbound engagement while leveraging inbound partnership inquiries to support growth. This position does not have supervisory responsibilities. Essential Duties and Responsibilities Identify and outreach to new strategic CMP partners with shared values to help the team build a strong pipeline and develop new partner relationships. Partnership lead opportunities will be provided. Execute community partner outreach, growth and stewardship strategy in collaboration with managers and other internal teams. Onboard assigned new partnership accounts. Meet or exceed annual individual KPI's and fundraising goals. Utilize approved communication (presentations, emails, phone, contracts) and messaging. Create and deliver formal and informal presentations to new partners in small and large environments (both in-person and virtual). Provide regular progress updates to manager and ensure account revenue forecasts are accurate each month and accounts are moving through the sales pipeline. Ensure that all required data is captured in Salesforce. Accurately and fully maintain all relevant partner records in Salesforce. Utilize exception reports to identify and correct any data errors or omissions. Collaborate with Operation Warm departments (Marketing, Programs, Accounting, and Operations) to ensure seamless program execution and drive partner satisfaction and growth. Train partners to access and utilize tools on our partner portal, assist with order configuration and placement, work to eliminate receivables, and answer partner questions as needed. Act as knowledge point and remain abreast of all current partner and team activities. Work harmoniously with all Operation Warm departments to exceed personal and organizational goals Attend (occasionally lead) and participate in Operation Warm in-person events Ensure forecast for assigned accounts is accurate Other duties, as assigned Basic Job Qualifications BA or BS undergraduate degree. 3 years account management or donor/client facing experience. Other Job Qualifications Experience with nonprofit organizations is a plus Experience working in high-growth, performance focused environments Demonstrated business acumen Experience in preparing and presenting to an audience Relationship oriented with excellent written and verbal communication skills Detail oriented with well-developed organization skills Demonstrated ability to work well with a team Must be flexible and adaptable Ability to organize and manage customer expectations and deliverables Ability to think on your feet and problem solve in real-time Highly proficient in Microsoft Suite (Word, Excel, PowerPoint, Teams, Outlook, OneNote) Experience with Salesforce and/or other CRM systems Spanish language proficiency a bonus/is preferred This position requires some travel Unwilling to accept any unethical conduct or outcomes that threaten the mission or values of Operation Warm *Operation Warm participates in E-Verify. In compliance with federal law, all persons hired will be required to verify identity and eligibility to work in the United States and to complete the required employment eligibility verification form upon hire

We are looking for a mid-level sales manager (business development manager) that can help us with client acquisition in IT services. Requirement: * Must carry past experience in selling IT/Tech services to clients * Must be able to help us by bringing in US based clients/companies to us that need big data services * 4+ years experience in IT sales * Proven sales figures from the past * Proven strong contacts with IT decision makers at large and medium size companies This position comes with a strong commission structure. Additional Information All your information will be kept confidential according to EEO guidelines.

Job DescriptionBusiness Development - Commercial HVAC (Union Market) Company: Quaker Mechanical Employment Type: Independent Contractor (1099) - Commission OnlyAbout Us Quaker Mechanical is a leading commercial HVAC contractor specializing in union projects. With a reputation for excellence, we deliver top-tier mechanical solutions in the union HVAC marketplace across the Cinnaminson area and beyond. Position Overview We're seeking a driven Business Development professional with a solid background in commercial construction sales within the union HVAC market. This is a 1099, commission- only opportunity designed for self-starting individuals eager to grow their income based on performance. Key Responsibilities Cultivate and maintain relationships with general contractors, developers, and union contacts. Identify and pursue new project opportunities in commercial HVAC. Negotiate and close deals aligned with company capacity and goals. Collaborate with internal teams (estimating, operations) to transition new projects smoothly. Provide market insights and strategic growth recommendations. Qualifications 2+ years of experience in commercial construction sales, with a focus on union HVAC. Familiarity with the union HVAC landscape and strong industry contacts. Excellent negotiation, communication, and relationship-building skills. Ability to work independently in a commission-based, 1099 role. Compensation Structure (Commission + Stipends) This role offers uncapped earning potential through a tiered commission on gross profit, plus fixed monthly stipends: 0.5% on $0 - $100,000 Contract amount 1.0% on $101,000 - $500,000 Contract amount 1.5% on $501,000 - $750,000 Contract amount 2.0% on $751,000 and above Contract amount $100/month cell phone stipend $300/month auto stipend

We have an exciting Sales role within our Health Research business with Ovid Technologies as a Senior Sales and Business Development Representative **Ovid Guidelines AI, an agentic GenAI solution** . This solution supports end-to-end guideline lifecycle management by uniting researchers, expert panels, and review boards through a shared, auditable environment for coordinating projects and capturing key evidence, deliberations, and decisions over time. The Senior Sales and Business Development Representative for **Ovid Guidelines** is responsible for building and maintaining effective long-term relationships and a high level of satisfaction with decision makers and influencers. You will be responsible for developing and implementing a comprehensive sales plan that includes new sales strategies for large societies and organizations publishing clinical guidelines. You will collaborate closely with colleagues from the Ovid Sales Team to establish new sales of Ovid Guidelines AI. Your role is pivotal in driving the growth and success of our company. You will be focused on generating new business for a new solution and will be at the forefront of expanding our client base by forging valuable partnerships with Medical Societies and Health Organizations nationally. **RESPONSIBILITIES** + **New Deal Generation:** Proactively seek out and identify potential clients and opportunities, with a primary focus on closing new multi-year deals. + **Lead Qualification:** Evaluate and qualify leads to ensure alignment with our target market and business objectives. + **Sales Strategy** : Develop and execute strategies to approach and engage prospective clients, tailoring your approach to meet their unique needs. + **Pitch and Presentation:** Conduct compelling sales presentations and demonstrations to showcase the value and benefits of our offerings. + **Negotiation and Closing:** Handle negotiations with prospective clients, addressing any objections, and guiding them through the sales process to secure new contracts. + **Pipeline Management:** Maintain and manage a robust pipeline of new business opportunities, tracking progress and reporting on key metrics. + **Proven Sales Experience:** Demonstrated success in sales roles, with a focus on acquiring new business and closing complex new business deals. + **Strong Negotiation Skills:** Ability to effectively negotiate terms and close deals while maintaining a positive client experience. + **Understanding of Society/Organization sales:** Role requires experience and proven history of success negotiating with and navigating with this market segment + **Strategic Mindset:** Skilled in developing and executing strategies to attract and convert new clients. + **Excellent Communication:** Exceptional verbal and written communication skills, with the ability to articulate complex solutions clearly and persuasively to a broad range of key stakeholders. + **Self-Motivated:** Highly driven and proactive, with a strong work ethic and a passion for achieving and exceeding sales targets. + **Experience with SAAS Sales in Healthcare:** Understanding of navigating budget, IT and procurement for new products in healthcare **QUALIFICATIONS** **Education:** bachelor's degree or equivalent experience **Experience:** + 5+ years field sales experience + Value-based selling skills + Challenger sales methodology preferred + Develop an understanding of each society's area of discipline + Software or Cloud sales experience + Healthcare/Medical Market + Understanding of how guidelines are created + Importance of standards of care - value of guidelines + How medical evidence is fine-tuned into guidelines for the medical users + Publishing, Information, or Health Technology industry preferred + Medical society contacts experience - understanding society goals, serving their membership + Sales experience to Societies - Navigating society decision-making + Knowledge about CRM Applications (e.g., Salesforce) **TRAVEL:** 20% \#LI-Remote **Our Interview Practices** _To maintain a fair and genuine hiring process, we kindly ask that all candidates participate in interviews without the assistance of AI tools or external prompts. Our interview process is designed to assess your individual skills, experiences, and communication style. We value authenticity and want to ensure we're getting to know you-not a digital assistant. To help maintain this integrity, we ask to remove virtual backgrounds and include in-person interviews in our hiring process. Please note that use of AI-generated responses or third-party support during interviews will be grounds for disqualification from the recruitment process._ _Applicants may be required to appear onsite at a Wolters Kluwer office as part of the recruitment process._ **Compensation:** $71,300.00 - $124,500.00 USD This role is eligible for Commission. _Compensation range listed is based on primary location of the position. Actual base salary offer is influenced by a wide array of factors including but not limited to skills, experience and actual hiring location. Your recruiter can share more information about the specific offer for the job location during the hiring process._ **Additional Information** **:** Wolters Kluwer offers a wide variety of competitive benefits and programs to help meet your needs and balance your work and personal life, including but not limited to: Medical, Dental, & Vision Plans, 401(k), FSA/HSA, Commuter Benefits, Tuition Assistance Plan, Vacation and Sick Time, and Paid Parental Leave. Full details of our benefits are available upon request. EQUAL EMPLOYMENT OPPORTUNITY Wolters Kluwer U. S. Corporation and all of its subsidiaries, divisions and customer/business units is an Equal Opportunity / Affirmative Action employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, disability, or protected veteran status.

Job DescriptionSalary: Gras Lawn, a commercial landscape company, is seeking an experienced Landscape Business Developer for the South Jersey Market. Your main responsibility is developing business with potential new customers, building and maintaining trusted relationships with key decision-makers, understanding their challenges, and creating value solutions. Your role also involves effectively identifying opportunities, gathering valuable intelligence, creating customer-centric proposals, collaborating with team members, meeting specific activity targets, and closing deals. The Business Developer focuses on strengthening Gras Lawns market presence and driving profitable growth. This position plays a key role in meeting long-term strategic objectives by fostering important customer relationships, identifying business opportunities, negotiating and closing deals, and maintaining a comprehensive understanding of the current market landscape. Identifyandunderstandthechallengesofprospectiveclientsanddevelopsolutions. Provideaccurateforecastsforsales,deliverables,andkeyperformanceindicators(KPIs). Achievesalesgoalswhilehavingtheabilitytoworkindependently. Usesalestechniquestofindnewcustomersandbuildlong-termbusinessrelationships.Also,focusonmarketingandpricingstrategies. Conductphoneprospecting,salespresentations,virtualdemonstrations,andcontractnegotiationswithminimalsupervision. Identifycustomerneedsandapplysolution-basedsellingtechniquestodemonstratethevalueof GrasLawnsserviceseffectively. Buildandnurturerelationshipswithpotentialandcurrentclients. Planyourdailyactivitiesandaimtomeetspecificperformancebenchmarkstoclosebusinessdealssuccessfully. ConsistentlyandreliablylogactivitiesintheCRM. Workeffectivelyinafast-pacedenvironmentwhilemaintainingastrongsenseofurgency. Communicateproactivelywithallclients,prospects,andcolleagues. SkillsRequired: ExtensiveexperienceintheCommercialLandscapeIndustry Proventrackrecordofsalesgoalattainmentandpipelinemanagement 3-5yearsofexperienceinB2Bsalesatmid-to-seniorlevels. Localknowledgeandcontactsinoneormoremarketsegments Proficientwithcomputerprograms,including AspireandaCRMtool Highlycompetitive,positive,andresults-driven Exceptionalmultitasker. Excellentoralandwrittencommunicationabilities,strongpresentationskills,andprofessionalexperiencewithsocialmedia. Passionate,organized,andresourcefulindividualwithoutstandinglisteningandinterpersonalskills. Highly organized, self-motivated, and hardworking, with effective time management capabilities. Easilyadaptabletonewsituations. Salary commensurate with experience. Youwillberesponsiblefor: TheBusinessDeveloperoverseesthesalespipelinefromtheprospectingstagetoclosingandisaccountablefortheentiresalescycle,includingsnowsalesincertainregions.Additionally,the BusinessDeveloperworksincollaborationwithpartnersacrossoperations,finance,marketing,andotherdepartmentstoeffectivelyrespondtobidsandachievesalesgoals. Salary commensurate with experience.

CORE is currently seeking a hardworking and experienced Title Insurance Sales Representative. Join one of South Jersey's fastest growing title companies and most successful title team! Whether you have a well-established client base or need help taking your business to the next level, we want to meet. Increase overall resale and refinance market share in the New Jersey and Pennsylvania market by building strong relationships with REALTORS, mortgage brokers and loan originators, banks, credit unions. Team player who acts as the liaison between the inside office staff and clients in the field. Must be confident in making cold calls, prospecting for leads, as well as maintaining current customer's needs. Strong social media presence is a plus. Develop and initiate new sales and marketing ideas. Actively pursue office presentations with office brokers and staff Knowledge of real estate business is extremely helpful. Consistently increase business and revenues Candidate must possess the following: Strong work ethic. Must provide own reliable transportation. Superior time management skills OTHER REQUIREMENTS: Attending outside functions both during the day and some evenings Excellent interpersonal communication skills (both written and verbal) Ability to effectively present information one-on-one and in group settings Maintain a professional appearance and providing a positive company image EDUCATION: Minimum High School or equivalent (required) Degree in Sales and Marketing (preferred) EXPERIENCE: 2-5 years of successful sales experience in the Real Estate industry Salary is commensurate with experience Job Type: Full-time

KLUS Pharma has a rapidly growing portfolio of therapeutic biologics. The development of antibody-based drugs is powered by strong innovation and increasing activities in licensing and development partnerships. The Biologics Business Development group is looking to hire a Business Development Associate at its office at Cranbury, NJ. A qualified candidate should hold a bachelor's degree in biology or related fields, or a business degree with industrial experience in biotech. This position is responsible for sourcing, investigating, and communication with potential and existing partners for business development, licensing, and strategic alliance. The Business Development Associate will also support market intelligence and technology scouting. Key Responsibilities : Business Development 60% Support Business Development activities in operational roles. Prepare marketing materials and promotion documents for KLUS Pharma's brand and Business Development initiatives. Conduct initial search and evaluation on potential partners for licensing and strategic alliance. Coordinate team meetings and discussions with internal groups and potential partners. Towards later stages in the Business Development/Licensing process, support due diligence, term negotiation, and launching of partnerships. Alliance Management 20% Build trust and seek value through alliance management with prospective and existing partners. In the early stage of partnership discussion, this includes identification of performance and development goals of the business partners, documentation of background and history of BD discussions, and maintenance of timely communication with partners. For existing alliance, keep tracking of ongoing programs against development plans and periodically report progress and findings. Market Intelligence 20% Support market intelligence and technology scouting. Search for and evaluate technologies that fit KLUS Pharma's development targets. Collect and analyze competition information. Summarize and present the analysis results internally to facilitate decision making in business strategies. Travel: Travel may be required to visit potential partners, attend conferences, etc, about 10%. Required Education and Experience: A bachelor's degree is required. 1-3 Years of industry experience in research, marketing, or finance is preferred with a bachelor's degree in biology or related fields. 1-3 Years of experience in the biotechnology, pharmaceutical, animal health industries is preferred with a business degree. Required Qualification: Understanding of the core concept and key definitions in biology, drug development, IP, and licensing. Excellent skills in written and spoken communication, including presentation, targeting internal and external groups. Abilities of working effectively with cross-function teams. Thorough knowledge and experience of using MS Office software such as Word, Outlook, and Powerpoint. Preferred Qualifications: Hands-on experience of market intelligence, competition analysis, or search and evaluate. Experience of maintaining website contents and social media. General knowledge of immunology and oncology. Working knowledge of project management. Be able to simultaneously track multiple projects against timelines and to report progress and status.

Empowering Financial Futures. For more than 65 years, Glenmede's independent ownership, innovation and unwavering commitment to our clients have made us a trusted partner for private wealth, endowment & foundation, and investment management clients. Our people are invaluable. Through a team-oriented environment, your knowledge, expertise and varied backgrounds contribute to thoughtful innovation. Our culture fosters opportunities for continuous career growth and development in all areas of the organization. Working at Glenmede, you will experience the infrastructure and resources of a large firm combined with the client and employee focus of an independently owned boutique. Private Wealth: Empowering the confident pursuit of purpose, passions and legacy through integrated wealth management. To us, wealth is not static or one-dimensional. The complexities of wealth management require an integrated approach to anticipating, understanding and addressing unique client circumstances. Our team of experts partners with every client to personalize solutions that lead to exceptional outcomes. Our success is determined by the success of our clients. This position will operate in a hybrid work environment, 3 days per week in the office. We have openings in multiple office locations (New York, NY, Philadelphia, PA, and Princeton, NJ). OVERVIEW: The role of the Business Development Associate is to partner with the Business Development team to identify, develop and cultivate new private clients and endowment and foundation clients. The associate will work creatively and entrepreneurially to design prospecting strategies as well as individualized plans designed to win new clients and generate revenue growth. This role will provide foundational sourcing, prospecting and client development skills necessary to be successful as a Business Development Officer. RESPONSIBILITIES: Business Development and Sales Support * Support the Business Development Team in implementation of a business plan and business development strategy. * Assist in identifying and attracting new revenue from high-net-worth individuals, families, and endowments and foundations, including taking responsibility for documenting new opportunities in Salesforce. * Identify and build lists of key influencers, intermediaries and centers of influence (e.g., attorneys, accountants, consultants) in target markets and properly document findings. * Track prospect contact information for follow-up using Salesforce. * Maintain and expand the database of prospects for Business Development Team. * Maintain history of business development activity and call data. * Analyze data to provide reports, access profitability, identify trends and make recommendations. * Obtain all required documentation, prepare, submit, and monitor New Business Acceptance and Fee Exception Forms. Sales * Source new sales opportunities through research and follow-up with outbound calls and emails to establish meetings for the Business Development Team and schedule follow-up appointments with Business Development Officers. * Leverage traditional as well as digital and social media in an effort to successfully prospect. * Apply knowledge of financial markets, core products and services, and Glenmede requirements when interacting with prospects to effectively identify and meet their objectives. * Proactively keep prospects updated on new product offerings and send prospects relevant product information (i.e.: market outlook materials, industry-specific research, etc.) which solidify and add value to the relationship. Presentations and Events * Help organize and execute events for clients and prospects, with an emphasis on follow-up strategies that increase the ROI of the events. * Assist in the customization of presentation materials advocating the uniqueness of prospective clients and develop/implement marketing plans for proactive outreach. * Participate Glenmede at relevant industry or firm conferences. Firm Building * Take an engaged role in firm-wide and private wealth group initiatives and projects, including technology integration, enhanced client service and increased productivity; take responsibility for implementing conclusions. REQUIRED QUALIFICATIONS: * Bachelor's degree. * Up to 5 years of experience required preferably within financial services, fiduciary, wealth management or the investment arena. PREFERRED QUALIFICATIONS: * Strong self-starter demonstrating initiative and resourcefulness. * Proven communication skills, analytical ability, consultative, problem resolution skills; ability to probe and listen to help prospects clarify needs and objectives. Ability to gather and present data to evaluate and develop action next steps. * Client-centric orientation and mindset, able to stay on top of prospect needs and initiate or prepare a timely response. Ability to manage prospects' expectations. * PC proficiency, including Word, Excel, PowerPoint. Headquartered in Philadelphia, PA, Glenmede has 9 office locations in the US. For further information, please visit ************************ Our Benefits Overview: * Competitive health and welfare benefits, including company HSA contributions * Numerous voluntary benefit choices available * Superior 401k match * Tuition reimbursement * Company subsidized commuter benefits * Generous paid time off, including parental leave * Plus more! Salary Range: $65,000 - $85,000 Actual compensation packages are based on several factors unique to each candidate, including but not limited to job-related knowledge and skills, experience, education/training, business needs, market demands, and geographical location. Base salary is only part of the total compensation package. Glenmede is an Equal Opportunity Employer and Prohibits Discrimination and Harassment of Any Kind: Glenmede is committed to the principle of equal employment opportunity for all employees and applicants and to providing employees with a work environment free of discrimination, retaliation, and harassment. All employment decisions, including hiring decisions, at Glenmede are based on business needs, job requirements and individual qualifications in full compliance with all local, state and federal laws prohibiting discrimination on the basis of any status protected by the laws or regulations in the locations where we operate. Glenmede will not tolerate discrimination or harassment based on any of these characteristics. **************************************************** We are not seeking agency assistance with this role. No agencies, third parties, or phone calls, please. Glenmede is not accepting unsolicited resumes from search firms. All resumes submitted by search firms to any employee at Glenmede via-email, the Internet, or directly without a valid written search agreement will be deemed the sole property of Glenmede, and no fee will be paid in the event the candidate is hired by Glenmede. #LI-Hybrid

John Evans' Sons, LLC was founded in 1850 and is America's Oldest Spring maker! We manufacture a wide variety of springs and mechanical assemblies and sell to an international customer base including many Fortune 500 companies. We have stood the test of time and enjoy an excellent reputation for our industry leading capabilities. Job Description We are seeking a highly motivated and results-driven Business Development Associate focused on new business development. This role is dedicated to generating new accounts through cold calling, prospecting, and networking, while representing the company at trade shows and industry events. The ideal candidate thrives on building relationships from the ground up and is comfortable with 60% or more travel to engage with prospects, customers, and industry partners. Proactively identify, pursue, and secure new business opportunities through cold calling, prospecting, and lead generation Build a strong sales pipeline by researching target markets and initiating contact with key decision-makers Follow up on quotations, proposals, and leads to successfully close business Represent the company at trade shows, conferences, and industry events to promote products and services Work closely with the other sales personnel to support customer requirements and ensure successful onboarding Conduct frequent in-person customer visits, requiring 60% or more travel, including overnight stays Stay informed on industry trends, market dynamics, and competitor activities to identify growth opportunities Maintain accurate records of customer interactions, pipeline status, and sales performance in CRM tools Qualifications Bachelor's degree in Business, Marketing, or a related field preferred Strong presentation, negotiation, and communication skills Self-motivated, results-oriented, and comfortable working independently Willingness and ability to travel 60% or more, including attending trade shows and industry events Proficiency with CRM systems and Microsoft Office Suite Additional Information We offer a very competitive salary, potential for a yearly performance bonus, excellent benefits including paid vacation, health, life, AD&D, STD/LTD options, and a 401(k) plan. John Evans' Sons LLC. is an equal opportunity employer and welcomes all applicants, EOE/AA. For immediate consideration, please mail your resume along with current earnings and salary requirements via U.S. mail to: Human Resources Manager John Evans' Sons, Inc. One Spring Ave. P.O. Box 885 Lansdale, PA 19446

We are a business development and sales company that executes promotional campaigns to drive sales on behalf of our brand partners. Our partners rely on us to increase revenue, generate positive experiences, and raise customer satisfaction ratings. The primary responsibility of the Business Development Associate is to create business and sales opportunities through direct-to-consumer campaigns. They will actively engage and deliver compelling product presentations in an effort to increase revenue and generate sales. Additionally, as the Business Development Associate, you will have the opportunity to take on leadership and managerial responsibilities upon successfully achieving KPIs set by senior management. If you're a passionate self-starter with an interest in business development, growth, and client relations, we look forward to hearing from you! What You'll Do as a Business Development Associate: Prospect potential customers/business opportunities by vetting warm leads Build and maintain relationships with customers, stakeholders, clients, and fellow staff Work closely with the sales and customer service teams to maintain KPIs at high levels Identify areas of improvement and communicate feedback professionally and effectively Monitor sales and customer service pipelines, track progress, and hold regular meetings with appropriate staff Examine profit and loss statements to ensure company funds are utilized appropriately Convert sales leads into valuable long-term customers by utilizing stellar customer service What We're Looking For in a Business Development Associate: A bachelor's degree or equivalent, preferred 1+ years of experience in business development and/or management, preferred Ambitious self-starters with a passion for client relations and business development Critical thinking skills, the ability to come up with creative solutions on your feet A team player who's able to communicate effectively with fellow staff and customers Familiarity with sales, lead generation, customer service, or business development practices is a plus Growth-oriented individuals looking to grow with a company long-term Why Join Us? Travel opportunities- all transportation & accommodation expenses covered! Internal growth opportunities- we only promote from within our company! Comprehensive business development guidance & mentorship Commission bonuses are available with uncapped earning potential Competitive weekly pay

Are you interested in working for a company that makes a difference in people's lives? Do you want to work for a company that values its employees and supports professional development? Joining the Prism Specialties Team Provides: Teamwork: Experience what it is like to work in a team environment surrounded by people who support and encourage you along the way Learning & Development: Develop your skill set within the company by increasing your knowledge and experience A Day in the Life of a Business Development Manager: Prospects for new customers to build a robust pipeline of qualified opportunities that lead to sales growth Build and maintain relationships with accounts/customers to understand the needs of the customer through research and initiative Maintain existing business relationships through ongoing communications Plan and attend local conferences, trade shows, and insurance association meetings Additional Activities Include: Schedule in-person sales visits, presentations, meetings, and outings Present our services to local business owners, contractors, and insurance adjusters Organize, document, and manage personal sales processes to identify obstacles and track success Proficient in using social media in selling process (LinkedIn, Facebook, and Instagram) Attain membership in local and national professional associations What We are Looking for in You: Experience in insurance claims or the restoration industry a plus Strong writing skills to prepare business correspondence and reports Solid presentation skills and comfortable speaking in front of an audience Strong time management skills and ability to multi-task as needed Ability to work independently with limited supervision Ability to work efficiently and effectively within a team environment Prism Specialties specializes in the restoration of electronics, art, textiles, and documents for residential and commercial insurance claims. Compensation: $45,000.00 - $55,000.00 per year For over 25 years, steady and calculated growth has evolved the company into a world-class operation in restoring electronics, art, textiles, and documents quickly and effectively. Since 1993 Prism Specialties has been making its mark recovering and restoring electronics specializing in both residential and commercial markets. As we strive to accommodate our customers and their restoration needs, Prism Specialties expanded into art restoration, document restoration, and textile restoration. Our teams specialize in recovery solutions for major disasters related to fire, water, lightening and vandalism. We provide high quality and cost-effective “hands-on” restoration services with appropriate turnaround times that contractors, claims professionals, and homeowners require. Those individuals who become part of our team are both knowledgeable and skilled. We offer a viable work environment with the ability to make a positive impact on the community and have more control over their future. This franchise is independently owned and operated by a franchisee. Your application will go directly to the franchisee, and all hiring decisions will be made by the management of this franchisee. All inquiries about employment at this franchisee should be made directly to the franchise location, and not to Restoration Specialties Corporate.

We have an exciting Sales role within our Health Research business with **Ovid Technologies** as a Senior Sales and Business Development Representative for the EBP, **Research and Quality Improvement Workflow solution - Ovid Synthesis.** This role is responsible for building and maintaining effective long-term relationships and a high level of satisfaction with decision makers and influencers. You will be responsible for developing and implementing a comprehensive sales plan that includes new and existing sales strategies for large key accounts. You will also collaborate closely with colleagues from the Ovid Sales Team to establish new sales of Ovid Synthesis at existing accounts, while also working independently to create secure new deals. Your role is pivotal in driving the growth and success of our company. Focused primarily on generating new business, you will be at the forefront of expanding our client base and forging valuable partnerships with Hospitals and Health Systems in the Central United States. **RESPONSIBILITIES** + **New Deal Generation:** Proactively seek out and identify potential clients and opportunities, with a primary focus on closing new business deals. + **Lead Qualification:** Evaluate and qualify leads to ensure alignment with our target market and business objectives. + **Sales Strategy:** Develop and execute strategies to approach and engage prospective clients, tailoring your approach to meet their unique needs. + **Pitch and Presentation:** Conduct compelling sales presentations and demonstrations to showcase the value and benefits of our offerings. + **Negotiation and Closing:** Handle negotiations with prospective clients, addressing any objections, and guiding them through the sales process to secure new contracts. + **Pipeline Management:** Maintain and manage a robust pipeline of new business opportunities, tracking progress and reporting on key metrics. + **Proven Sales Experience:** Demonstrated success in sales roles, with a focus on acquiring new business and closing complex new business deals. + **Strong Negotiation Skills:** Ability to effectively negotiate terms and close deals while maintaining a positive client experience. + **Strategic Mindset:** Skilled in developing and executing strategies to attract and convert new clients. + **Excellent Communication:** Exceptional verbal and written communication skills, with the ability to articulate complex solutions clearly and persuasively. + **Self-Motivated:** Highly driven and proactive, with a strong work ethic and a passion for achieving and exceeding sales targets. + **Experience with SAAS Sales in Healthcare:** Understanding of navigating budget, IT and procurement for new products in healthcare **QUALIFICATIONS** **Education:** Bachelors degree preferred, or equivalent experience **Experience** + 5+ years of field sales experience; or related experience + Complex sales and solution selling experience + Knowledge of hospital quality improvement industry preferred + Experience negotiating with hospital leadership, information technology, and Procurement + Publishing or Information industry would be a plus + Clinical market experience + Knowledge of Windows, Internet/WWW, CRM Applications, and Salesforce + Interpersonal skills and the ability to collaborate seamlessly across departments within Health Research + Intrinsically self-motivated, quick learner, autonomous self-starter, disciplined time management and result-driven **TRAVEL:** There will be travel as part of this role. Approximately 10-20% **About Us:** Within the Health Division of Wolters Kluwer, the Health Research business provides health solutions that help clinical professionals learn, practice and conduct research and advance their careers using market-leading tools and evidence-based information. \# LI-Remote **Our Interview Practices** _To maintain a fair and genuine hiring process, we kindly ask that all candidates participate in interviews without the assistance of AI tools or external prompts. Our interview process is designed to assess your individual skills, experiences, and communication style. We value authenticity and want to ensure we're getting to know you-not a digital assistant. To help maintain this integrity, we ask to remove virtual backgrounds and include in-person interviews in our hiring process. Please note that use of AI-generated responses or third-party support during interviews will be grounds for disqualification from the recruitment process._ _Applicants may be required to appear onsite at a Wolters Kluwer office as part of the recruitment process._ **Compensation:** $71,300.00 - $124,500.00 USD This role is eligible for Commission. _Compensation range listed is based on primary location of the position. Actual base salary offer is influenced by a wide array of factors including but not limited to skills, experience and actual hiring location. Your recruiter can share more information about the specific offer for the job location during the hiring process._ **Additional Information** **:** Wolters Kluwer offers a wide variety of competitive benefits and programs to help meet your needs and balance your work and personal life, including but not limited to: Medical, Dental, & Vision Plans, 401(k), FSA/HSA, Commuter Benefits, Tuition Assistance Plan, Vacation and Sick Time, and Paid Parental Leave. Full details of our benefits are available upon request. EQUAL EMPLOYMENT OPPORTUNITY Wolters Kluwer U. S. Corporation and all of its subsidiaries, divisions and customer/business units is an Equal Opportunity / Affirmative Action employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, disability, or protected veteran status.