Account executive jobs in Berkeley, NJ

Territory: Toms River, NJ - Multi-Specialty Target city for territory is Toms River - will consider candidates who live within 40 miles of territory boundaries with access to a major airport. Territory boundaries include: Atlantic City, Lakewood, Burlington. SUMMARY: Are you a results-driven biopharmaceutical sales professional looking to be part of an organization that values being curious, adaptable, and accountable? Lundbeck is a global biopharmaceutical company focusing exclusively on brain health. With more than 70 years of experience in neuroscience, we are committed to improving the lives of people with neurological and psychiatric diseases. Lundbeck employees are inspired and driven by our purpose to advance brain health and transform lives. Join us on our journey of growth! We are seeking a dynamic and results-driven sales professional with a proven track record of success who is looking to grow with LundbeckOur ideal candidate will have the ability to be a specialty product expert with an understanding of requisite market complexities in order to be successful promoting our products to stakeholders in the primary care and neurology settings. As an Account Manager, you lead the promotion of our psychiatry portfolio, executing sales and marketing strategies with comprehensive clinical knowledge to drive sales performance. Our Account Managers are adept at executing against the toughest commercialization challenges in today's rapidly changing environment and must demonstrate strong capability in the following areas: ESSENTIAL FUNCTIONS: Business Planning & Account Leadership - Ability to use digital tools and apply data-based insights to create opportunities, develop strategy & tactics, allocate resources to enhance sales execution, monitor progress and adjust direction to maximize sales performance. Selling - Deliver messages in a clear and compelling way to customers, effectively probe customer needs to handle objections, and close every call with a commitment to action to drive changes in behavior. Customer Development - Build and maintain productive internal and external relationships based on customer needs and organizational goals, incorporating “total office” account management where applicable. Local Market & Therapeutic Area Expertise - Gather and validate key trends and dynamics in the market, map account linkages, and apply comprehensive therapeutic knowledge to uncover and prioritize unique opportunities. Reimbursement - Consistently demonstrate the ability to stay informed on reimbursement dynamics, anticipate and effectively address payer access issues (IDNs, Medicare, Medicaid, Commercial) using Lundbeck resources. Pharmaceutical Environment/Compliance - Apply knowledge of pharmaceutical and regulatory environment, including accountability and adherence to Lundbeck policies and procedures and FDA regulations regarding the promotion of pharmaceutical and medical products. REQUIRED EDUCATION, EXPERIENCE and SKILLS: Bachelor of Arts or Bachelor of Sciences degree from an accredited college or university 2-5 years pharmaceutical, biopharmaceutical, biologics, medical device sales or related healthcare sales experience. Must demonstrate the intellectual capacity to score highly on disease and product training exams, including being certified on product knowledge annually Self-starter, with a strong work ethic, tenacity, and outstanding communication skills Adaptability: Ability to embrace change and work collaboratively in a fast-paced team environment. Problem-Solving: Proven analytical skills to identify solutions and overcome obstacles. Data Analysis: Strong computer and technical skills used in analyzing data to develop both short- and long-term goals aligned with business objectives. Must live within 40 miles of territory boundaries Driving is an essential duty of this job; must have a valid driver's license with a safe driving record that meets company requirements Meeting and complying with reasonable industry-standard credentialing requirements of healthcare providers / customer facilities is required for continued employment with Lundbeck Ability to lift, bend, push, pull and move items including, but not limited to equipment, pharmaceutical samples, and any other work-related materials up to 25 lbs. with or without reasonable accommodation. PREFERRED EDUCATION, EXPERIENCE AND SKILLS: Recent documented successful experience selling to general practitioners (GPs) and primary care centers. Prior experience promoting and detailing products specific to CNS/neuroscience Previous experience working with alliance partners (i.e., co-promotions) TRAVEL: Willingness/Ability to travel up to 30% - 40% domestically to (a) regularly meet/interact with customer base and internal personnel within assigned territory; and (b) typically attend 4-8 internal/external conferences and meetings spanning locations within the United States. Travel must be able to be completed in a timely manner. The range displayed is a national range, and if selected for this role, may vary based on various factors such as the candidate's geographical location, qualifications, skills, competencies, and proficiency for the role. Salary Pay Range $108,000 to $125,000 and eligibility for a sales incentive target of $39,000. Benefits for this position include flexible paid time off (PTO), health benefits to include Medical, Dental and Vision, company match 401k and company car. Additional benefits information can be found on our career site. Applications accepted on an ongoing basis. Why Lundbeck Lundbeck offers a robust and comprehensive benefits package to help employees live well and protect their health, family, and everyday life. Information regarding our benefit offering can be found on the U.S. career site. Lundbeck is committed to working with and providing reasonable accommodations to disabled veterans and other individuals with disabilities during our employment application process. If, because of a disability, you need a reasonable accommodation for any part of the application process, please visit the U.S. career site. Lundbeck is proud to be an equal opportunity workplace. We are committed to equal employment opportunity regardless of race, color, religion, sex, sexual orientation, gender identity, age, national origin, disability, protected veteran status, and any other characteristic protected by law, rule, or regulation. Lundbeck participates in E-Verify.

Securitas Technology, part of Securitas, is a world-leading provider of integrated security solutions that protect, connect, and optimize businesses of all types and sizes. More than 13,000 colleagues in 40 countries are focused daily on our purpose to help make your world a safer place and our commitment to deliver an unparalleled client experience. With clients at the heart of all we do, our people, knowledge, and technology power our connected ecosystem of health, safety and security solutions and services. As a trusted leader in systems integration and alarm monitoring, we bring the Securitas Technology Difference to life- delivering a comprehensive suite of video surveillance, access control, intrusion detection, fire safety, and integrated security solutions. As we continue to experience rapid growth in our Electronic Security division, we are seeking an Account Executive to drive new business development in our Core Commerical division. This role focuses on lead generation, relationship building, and presenting our commercial electronic security products and services to prospective clients. Job Responsibilities: Manage a defined territory using CRM tools, skilled in cold calling, networking, lead generation, and negotiation. Demonstrate ability to develop and implement comprehensive service/account outsourcing strategies Identify and pursue new business opportunities within the core commercial market segment. Prepare and present tailored proposals and solutions based on client needs and industry trends. Collaborate with internal specialists to design and deliver custom solutions for complex client needs. Participate in networking events, trade shows, and industry forums to build brand presence and identify prospects. Conduct a minimum of 10 in-person client meetings per week within the assigned territory to foster relationships, drive engagement and new business. Drive revenue growth by applying solution-based selling strategies to expand existing accounts and secure new logo clients. Minimum Requirements: High School diploma or GED required; Bachelor's degree preferred At least 2 years of experience in B2B sales with a consultative approach. Minimum 2 years of experience attaining or exceeding high sales quotas in comparable accounts and/or markets Proficient in leveraging Office Suite and CRM platforms to streamline workflows, increase productivity, and enhance client interactions. Travel is required across assigned geographic areas Highly organized, detail-oriented, and an effective communicator Background in electronic security sales is strongly preferred A valid driver's license is required Comprehensive Benefits: Base salary plus competitive commission on product and recurring revenue sales Monthly auto allowance Paid company training and development Medical, Dental, Vision, Life, and Critical Illness Insurance Company Paid Short Term and Long-Term Disability 401K with 60% Match up to 6% of salary Paid vacation, holiday, and sick time Tuition Reimbursement Exceptional career advancement opportunities Exclusive employee discounts on travel, electronics, and more We are a nationwide provider of security solutions, and an equal opportunity employer committed to a diverse workforce. Our core values of Integrity, Vigilance and Helpfulness are proudly demonstrated daily by our employees to our clients and the communities we service.

Home Care | Cherry Hill & Pitman, NJ Comfort Keepers - Central & Southern New Jersey At Comfort Keepers, we do more than provide care-we Elevate the Human Spirit . Every relationship we build helps seniors live safely, independently, and with dignity in the place they call home. We are seeking a Sales Representative / Business Development Manager who is energized by meaningful work, values long-term relationships, and understands how thoughtful outreach drives both growth and impact. Why this role matters This position is not about “selling hours.” It is about building trust with healthcare and community partners so families know who to call when care is needed most-after a hospitalization, during a transition home, or when independence becomes harder. Your work directly supports: Seniors aging safely at home Families navigating difficult decisions A care team committed to compassion and excellence What you'll do Build and nurture professional relationships with hospitals, rehab/SNF discharge teams, physicians, senior living communities, and community partners Serve as a trusted local resource for private pay and VA home care services Develop and execute a structured outreach plan for your territory (Cherry Hill and/or Pitman) Represent Comfort Keepers at networking events, professional meetings, and community programs Collaborate closely with intake and operations to ensure smooth transitions from referral to care Track activity, relationships, and outcomes using CRM tools Who you are A relationship-first professional with healthcare, home care, hospice, or senior living outreach experience Comfortable initiating conversations, following up consistently, and building credibility over time Organized, self-directed, and able to manage a territory with intention Values-driven, empathetic, and aligned with serving seniors and their families Valid driver's license and willingness to travel locally Compensation & growth We offer a competitive compensation package with strong upside tied to impact and results. Base salary: $55,000-$70,000 (based on experience and scope) Incentives: Performance-based bonuses tied to new client starts and sustained care On-target earnings: $80,000-120,000 Additional benefits may include mileage reimbursement, paid time off, holidays, and growth opportunities within a respected national brand. About Comfort Keepers Comfort Keepers is a leading provider of in-home care for seniors and adults needing assistance. Our caregivers provide Interactive Caregiving™, focusing on physical, emotional, and social well-being-because care is about connection, not just tasks. If you are motivated by purpose, relationships, and measurable growth-and want your work to truly matter-we'd love to talk. Benefits: ✔ 401(k) with match ✔ Health, dental, vision ✔ Paid time off 👉 Apply on LinkedIn or send your resume with a brief note about your healthcare outreach experience.

Role: Territory Sales Representative Job Summary: The Territory Sales Representative (TSR) is responsible for planning and managing territory activities to achieve sales and market share growth utilizing approved sales and marketing strategy and tools while providing excellent customer service to all customers in territory. The Territory Sales Representative is responsible for sales and administration of their territory. Location: South New Jersey Benefits Health Insurance (includes teledoc, virtual health, FSA, HCSA & other benefits) Dental Insurance Vision Insurance Life Insurance Health Spending Account Employee Support and Mental Wellness Short term disability 401k Match Paid Vacation Floating Days Employee Assistance Program Employee Engagement Events Awards and Recognition Tuition reimbursement Service Awards Employee Perks & Discounts Job Responsibilities Develop relationships and grow sales with assigned distribution customers in territory Frequently contact roofing contractors, remodelers, builders, and architects to drive demand Present products and programs to qualified distributors and end users on a weekly basis Perform product knowledge (PK) training sessions with customers Manage territory pricing based on competitive situations Follow up on inquiries from customers or IKO administration in a timely fashion Submittal of weekly Intelligence Reports in a timely fashion Manage customer accounts receivable balance and deductions Investigate and process product quality complaints in territory Organize and execute a business plan to meet territory sales goals and customer needs Utilize approved sales/marketing tools within budget Increase IKO market share in territory Timely and effective communication of market and competitive information as well as requests for pricing or payment exceptions. Develop relationships and grow sales with assigned distribution customers in territory. Attend meetings, functions and company provided training as required Manage customer accounts receivable balance and deductions Adhere to Health and Safety policies as well as IKO Vehicle policies Any other responsibilities as assigned Qulaifications Associate's Degree required; Bachelor's Degree preferred. A driver's License in good standing is required. 3 years of prior sales experience in the building products industry preferred Strong attention to detail with a professional and results-driven attitude. Proficient in Microsoft Office and other essential business software. Excellent interpersonal, communication, and presentation skills. Highly detail-oriented with a strong commitment to task completion. Proactive, deadline-focused, and adept at managing multiple priorities. Capable of working effectively both independently and collaboratively in a team environment. Skilled in engaging end users and executing “pull-through” sales techniques. Proven track record of consistently meeting and exceeding sales targets. Work Environment Work is generally performed within a customer retail, distribution, or home office environment. Physical Demands Must be able to remain in a stationary position 50% of the time Must be able to work flexible hours (including nights and weekends) to complete tasks as assigned The person in this position needs to occasionally move about inside the office to access file cabinets, office machinery, etc. Constantly operates a computer and other office productivity machinery, such as a calculator, copy machine, and computer printer Travel Up to 100% travel may be required Must be willing to consider relocation for future opportunities. Additional/Preferred Requirements Prior sales experience calling on roofing contractors, builders and/or architects preferred Prior professional sales training preferred #LI-TM1

🚀 Now Hiring: Sales Client Representative | Commercial Construction | HAMILTON, NJ 🚀 Are you a proven hunter with a track record of winning new business? We're seeking a Sales Client Representative to drive growth in commercial new construction projects valued at $1M-$1.5M. About the Role You'll manage the full sales cycle (6-18 months) within a defined territory-prospecting, qualifying, and closing deals. Backed by an experienced estimating/bidding team, you'll build relationships with general contractors, project managers, landscape architects, developers, and C-level executives to deliver large-scale commercial landscaping projects. Responsibilities Build and manage a regional sales pipeline from lead to close Develop and maintain relationships with key decision makers Collaborate with internal teams to deliver winning proposals Achieve and exceed individual and regional sales goals Qualifications 2-7 years of B2B outside sales in the construction industry Proven success hitting and exceeding quotas Experience managing long, complex sales cycles Strong communication and presentation skills High energy, persistence, and results-driven mindset Why This Opportunity? Partner with the #1 commercial landscaping company in North America Contribute to high-profile projects-stadiums, HQs, landmark parks, and more Backed by a publicly traded, $1.5B+ organization with 20,000+ employees 📩 If you're ready to grow your career and close big deals, let's connect. Please email me at: ***********************************

The Sales Consultant is all about the client, and represents a trusted advisor for visitors to our stores, callers on our phones, and customers who come to us through online channels. Primarily responsible for providing an exceptional experience for all clients by utilizing in-depth knowledge of selling skills, merchandise, client services, and security & operations. The Senior Advisor helps Hamilton customers find what they're looking for or, in many cases, helps them discover what they didn't know they were looking for This position may be required to work weekends, some holidays, and peak sales periods. Responsibilities Greet clients and engage them to establish their needs. Promote and present merchandise and services available to clients, describing features, benefits, and value. Probe, recommend, select, or assist in locating merchandise based on clients' needs and desires. Maintain familiarity with product lines, merchandise sources, and Hamilton sources. Maintain knowledge of current promotions, policies and procedures, and security practices. Maintain up-to-date knowledge of competitors' merchandise mix, vendors, strengths and weaknesses. Keep organized and updated client profile information, special orders, and other required company documentation to guarantee compliance, client satisfaction; and for building long-term relationships. Manage any client service issues while maintaining the brand's high standards, using all appropriate resources, in a timely manner to ensure complete client satisfaction. Achieve or exceed established individual sales goals, add-on percentages, gross margin goals, and improved average sales. Set-up and maintain showcases visually displaying designs by collection, using appropriate forms, ensuring quality assurance, cleanliness, and security of merchandise. Complete and reconcile daily cycle counts and semi-annual inventories. Prepare sales slips and present pricing to clients; accept payment and enter sales into system. Comply with company insurance regulations and shipping policies. Uphold a team approach to ensure high levels of client satisfaction, adherence to Hamilton Mission, Vision, and Core Values, and personal career growth. Attend regularly scheduled staff training meetings and in-store vendor trainings to ensure development. Utilize effective communication skills with internal team members, and maintain open communication with the Store Director. Skills Existing product knowledge, and/or openness to mastering products and services. Client service prowess. Ability to read and react to different situations. Ability to work with a diverse client base. Ability to develop relationships beyond the individual transaction. Strong interpersonal and negotiation skills. Strong team player. Computer proficiency.

PagerDuty, Inc. (NYSE:PD) is a global leader in digital operations management. Trusted by nearly half of both the Fortune 500 and the Forbes AI 50, as well as approximately two-thirds of the Fortune 100, PagerDuty is essential for delivering always-on digital experiences to modern businesses. Join us. (******************************* At PagerDuty, you'll tackle complex problems, collaborate with kind and ambitious people, and help build a more equitable world-all in a flexible, award-winning workplace. **Overview of the Role** PagerDuty seeks an Enterprise Account Executive with a proven track record of acquiring new business and driving growth within existing accounts. This dynamic role requires balancing hunting for new opportunities and nurturing relationships with current customers while selling our SaaS products to Enterprise-level organizations. Reporting to a Regional Sales Director, you will be pivotal in expanding our customer base and maximizing value within existing accounts. In this role, you will manage a diverse pipeline of opportunities from new logos and within our existing customer base, ensuring a balanced focus on acquisition and retention. Your target accounts will align with our ideal customer profile, focusing on organizations with $500 million+ in revenue. You will be responsible for approximately 12-20 key accounts, emphasizing securing new business while expanding and deepening relationships in current accounts. Your ability to navigate multi-product solutions and engage with various stakeholders across new and existing accounts will be essential to success. At PagerDuty, we value customer-centric sales strategies and highly emphasize delivering exceptional experiences. Your mission will be to drive new sales and ensure our existing customers continue to realize the full value of our products and services. This is more than just a sales role-it's an exciting opportunity to showcase your skills in new business acquisition and account growth, leveraging your tech savvy to influence potential and current customers. Join us at PagerDuty and help us deliver robust solutions that make an impact across both new logos and existing partnerships! **Key Responsibilities:** Value Selling: + Highlight the unique value our products and services provide, addressing the challenges of new prospects and the evolving needs of existing customers. + Focus on building long-term relationships by solving customer pain points with tailored solutions. + Develop a deep understanding of customer needs to position PagerDuty as a strategic partner for new and current clients. Sales Effectiveness: + Establish and maintain strong, consultative relationships with new prospects and existing clients. + Drive new business and expand existing accounts by identifying upsell and cross-sell opportunities. + Effectively manage complex, multi-product sales cycles across new and existing accounts, focusing on delivering strategic outcomes. + Lead high-level conversations with senior executives (VP+) to drive interest, align initiatives, and secure support for new projects. + Present tailored solutions, building credibility and trust, and demonstrating the value of PagerDuty's offerings. Account Growth & Acquisition: + Focus on acquiring new logos while nurturing and expanding relationships within existing accounts. + Utilize a mix of inbound and outbound prospecting, including leveraging marketing, alliances, and BDR programs to identify and qualify new opportunities. + Develop tailored strategies to penetrate target accounts and identify decision-makers, influencers, and key stakeholders. + Collaborate with internal teams and resources to ensure effective territory and account management. Sales Execution: + Drive sales cycles by ensuring accurate forecasting, managing pipelines effectively, and closing deals with new and existing customers. + Coordinate with internal teams to ensure customer needs are met and all commitments are fulfilled, contributing to long-term strategic growth. + Document key customer interactions, including qualification, next steps, and value propositions using frameworks like MEDDICC and COM. Planning & Strategy: + Develop a strategic plan to map out target accounts, identify priorities, and collaborate with cross-functional teams to drive growth. + Use historical data, market insights, and competitive intelligence to inform sales strategies and forecasts accurately. **Basic Qualifications:** + 8+ years of field sales experience, preferably in SaaS or software sales. + 4+ years of experience managing existing accounts and expanding into new areas within those accounts. + Enterprise Account Management experience with $500M+, Fortune 500 and Global 2000 companies + Previous experience in a multi-product selling environment. + Ability to travel approximately 30%. **Preferred Qualifications:** + Proven success in acquiring new business while growing existing accounts. + Strong time management, deal management, and analytical skills. + Consistent track record of exceeding sales targets in both acquisition and account expansion. + Experience with MEDDIC, SPIN, Challenger Sales, and similar sales methodologies. The base salary range for this position is 130,000 - 160,000 USD. This role may also be eligible for bonus, commission, equity, and/or benefits. Our base salary ranges are determined by role, level, and location. The range, which is subject to change based on primary work location, reflects the minimum and maximum base salary we expect to pay newly hired employees for the position. Within the range, we determine pay for an individual based on a number of factors including market location, job-related knowledge, skills/competencies and experience. **Hesitant to apply?** We encourage you to submit your resume even if you don't meet every requirement. We value potential and consider each candidate's full professional story. Whether you're exploring a career change or taking your next step, we look forward to reviewing your application. If this just isn't the right role or time - sign up for job alerts (**************************************** ! **Where we work** PagerDuty operates a hybrid work model with offices (**************************************** in 8 major cities: Atlanta, Lisbon, London, San Francisco, Santiago, Sydney, Tokyo, and Toronto. While we offer flexibility within our established locations, we **cannot** employ candidates residing in: **Location restrictions:** **Australia:** Northern Territory, Queensland, South Australia, Tasmania, Western Australia **Canada:** Alberta, Manitoba, Newfoundland, Northwest Territories, Nunavut, PEI, Quebec, Saskatchewan, Yukon **United States:** Alaska, Hawaii, Iowa, Louisiana, Mississippi, Nebraska, New Mexico, Oklahoma, Rhode Island, South Dakota, West Virginia, Wyoming _Candidates must reside in an eligible location, which vary by role._ **How we work** Our values (************************************** guide how we support customers, collaborate with colleagues, develop products, and foster a culture of belonging. They define not just our actions, but what it means to be Dutonian. People Leaders at PagerDuty are responsible for creating high performance environments that drive accountability. PagerDuty has four key dimensions that define our Leadership Impact: Lead Self, Lead the Team, Lead the Business, and Lead the Future. Each dimension has three associated competencies to give leaders a shared language for guiding their development, career, promotion, and succession planning discussions. Our Manager Expectations serve as a practical guide for managers to understand their responsibilities, prioritize their efforts, and drive engagement and performance. **What we offer** As a global organization, our total rewards approach is competitive with industry standards and aligned with local laws and regulations. Learn more, including country-specific offerings, on our benefits site (********************************************** . **Your package may include:** + Competitive salary + Comprehensive benefits package + Flexible work arrangements + Company equity* + ESPP (Employee Stock Purchase Program)* + Retirement or pension plan* + Generous paid vacation time + Paid holidays and sick leave + Dutonian Wellness Days & HibernationDuty - companywide paid days off in addition to PTO + Paid parental leave: 22 weeks for pregnant parent, 12 weeks for non-pregnant parent (some countries have longer leave standards and we comply with local laws)* + Paid volunteer time off: 20 hours per year + Company-wide hack weeks + Mental wellness programs *Eligibility may vary by role, region, and tenure **About PagerDuty** PagerDuty, Inc. (NYSE:PD) is a global leader in digital operations management. The PagerDuty Operations Cloud is an AI-powered platform that empowers business resilience and drives operational efficiency for enterprises. With a generative AI assistant at its core, PagerDuty empowers teams to detect and resolve issues in real time, orchestrate complex workflows, and drive continuous improvement across their digital operations. Trusted by nearly half of both the Fortune 500 and the Forbes AI 50, as well as approximately two-thirds of the Fortune 100, PagerDuty is essential for delivering always-on digital experiences to modern businesses PagerDuty is Great Place to Work-certified, a Fortune Best Workplace for Millennials, a Fortune Best Medium Workplace, a Fortune Best Workplace in Technology, and a top rated product on TrustRadius and G2. Go behind-the-scenes on our careers site (*********************************** and @pagerduty on Instagram. **Additional Information** PagerDuty is an equal opportunity employer. PagerDuty does not discriminate on the basis of race, religion, color, national origin, gender, sexual orientation, age, marital status, parental status, veteran status, or disability status. Your privacy is important to us. By submitting an application, you confirm that you have read and understand PagerDuty's Privacy Policy (****************************************** . PagerDuty is committed to providing reasonable accommodations for qualified individuals with disabilities in our job application process. Should you require accommodation, please email accommodation@pagerduty.com and we will work with you to meet your accessibility needs. PagerDuty uses the E-Verify employment verification program.

With 80,000 customers across 150 countries, UKG is the largest U.S.-based private software company in the world. And we're only getting started. Ready to bring your bold ideas and collaborative mindset to an organization that still has so much more to build and achieve? Read on. At UKG, you get more than just a job. You get to work with purpose. Our team of U Krewers are on a mission to inspire every organization to become a great place to work through our award-winning HR technology built for all. Here, we know that you're more than your work. That's why our benefits help you thrive personally and professionally, from wellness programs and tuition reimbursement to U Choose - a customizable expense reimbursement program that can be used for more than 200+ needs that best suit you and your family, from student loan repayment, to childcare, to pet insurance. Our inclusive culture, active and engaged employee resource groups, and caring leaders value every voice and support you in doing the best work of your career. If you're passionate about our purpose - people -then we can't wait to support whatever gives you purpose. We're united by purpose, inspired by you. UKG is seeking a highly motivated Enterprise Account Executive, who will be responsible for net-new logo sales in our S&D West business segment. While each AE owns a few upsell accounts, this is a true Hunter role. If you are a highly successful HRMS/Payroll salesperson and have followed the growing success of our company, then you know that we rarely have an opening in our sales ranks. Why? Because we hire only the best HRMS/Payroll Reps and arm them with the best products, support personnel, and tools to ensure long-term success with us. Now it's your turn for an opportunity to build your sales legacy: we are expanding our sales force and are looking for the very best to represent UKG. **About You:** - 5-7+ years proven success selling cloud/SaaS solutions to C level. HRMS/Payroll experience a strong plus. - Consistently exceed a $2 Million+ quota - 3+ years selling complex deals over $800K in ARR - Demonstrated experience building a territory and pipeline from scratch - Consistently execute a thoughtful, strategic sales process including internal business partners and executive engagement. Challenging? Yes! UKG expects a lot of our AE's and we provide a lot for our reps to succeed: - Tenured management who are skilled at guiding highly successful sales personnel - Seasoned Application Consultant team to assist with proposals, RFPs, and demos - Expert Technical Sales Support - Highly reference-able customer base with 96% customer retention with our hosted SaaS solution - Solid Sales Operations and Legal staff focused on helping process and close contracts quickly - Award-winning HRMS/Payroll, Talent Management, and Time and Attendance solutions, consistently outperforming our competitors' products - Software-as-a-Service solution for the growing number of companies relying upon SaaS benefits - Award-winning Implementation and Customer Support teams dedicated to bringing customers live in industry-record timeframes - A company culture that breeds and supports success at every level, putting our employees first! Rewarding? Absolutely! You will have confidence in the performance of the solutions you sell and also in the quality of service your customers will receive, ensuring your accounts will be satisfied with their decision to go with UKG. UKG offers generous escalating commission percentages, and club locations are luxurious. **Travel Requirement:** - 30-40% **Where We're Going:** UKG is on the cusp of something truly special. Worldwide, we already hold the #1 market share position for workforce management and the #2 position for human capital management. Tens of millions of frontline workers start and end their days with our software, with billions of shifts managed annually through UKG solutions today. Yet it's our AI-powered product portfolio designed to support customers of all sizes, industries, and geographies that will propel us into an even brighter tomorrow! **Pay Transparency:** The base salary range for this position is $140,000 annually; however, base pay offered may vary depending on skills, experience, job-related knowledge and location. This position is also eligible for commissions and restricted stock unit awards as part of an industry leading total compensation package. Information about UKG's comprehensive benefits can be reviewed on our careers site at *************************** . **Equal Opportunity Employer:** UKG is an equal opportunity employer. We evaluate qualified applicants without regard to race, color, disability, religion, sex, age, national origin, veteran status, genetic information, and other legally protected categories. View **The EEO Know Your Rights poster (************************************************************************************************** ** UKG participates in E-Verify. View the E-Verify posters **here (******************************************************************************************** . ** It is unlawful in Massachusetts to require or administer a lie detector test as a condition of employment or continued employment. An employer who violates this law shall be subject to criminal penalties and civil liability. **Disability Accommodation in the Application and Interview Process:** For individuals with disabilities that need additional assistance at any point in the application and interview process, please email ****************** . It is the policy of Ultimate Software to promote and assure equal employment opportunity for all current and prospective Peeps without regard to race, color, religion, sex, age, disability, marital status, familial status, sexual orientation, pregnancy, genetic information, gender identity, gender expression, national origin, ancestry, citizenship status, veteran status, and any other legally protected status entitled to protection under federal, state, or local anti-discrimination laws. This policy governs all matters related to recruitment, advertising, and initial selection of employment. It shall also apply to all other aspects of employment, including, but not limited to, compensation, promotion, demotion, transfer, lay-offs, terminations, leave of absence, and training opportunities.

ITC WORLDWIDE is seeking a dynamic and experienced Microsoft Business Applications Senior Sales Consultant WFH or an ITC field office Are you passionate about selling business applications solutions that empower organizations to achieve more? Do you have a proven track record of delivering results in a complex and competitive market? Do you have experience with Microsoft Dynamics 365 Finance & Operations or other ERP systems? If so, we want to hear from you. To be successful in this position you will possess the following attributes: Motivated and proactive professional with previous experience in end-to-end sales within Microsoft or equivalent Enterprise Applications. 5+ years face-to-face selling experience - Microsoft product suite expertise including D365, PowerApps and Business Central is highly regarded. Demonstrated ability to hunt new business opportunities. Ability to build and foster strong customer relationships in existing customer base. A strong customer-centric approach and ability to network across a complex organization. Skills in managing multiple commercial processes (new business sales), forecasting precisely and identifying challenges to positive commercial outcomes. Develop and execute a sales strategy in designated territories and work with both vendor and Industry teams to execute. Arrange and conduct customer meetings, serve as trusted advisor by understanding a customer's existing and future digital transformation roadmap and driving the sales. Strong networking skills and industry experience Ability to drive new business and get engaged with lead generation. Liaising with solution consultants to drive correct business outcomes. Desire to be involved in a rapidly growing business and take a leadership role in helping it thrive. Strong personality motivated by continual improvement and self-development Responsibilities: Develop and execute sales strategies to grow revenue and market share in the Finance & Operations segment. Build and maintain strong relationships with key decision makers and influencers across various industries and geographies. Understand customer needs and pain points and propose value-added solutions that leverage Microsoft's D365 platforms and applications. Collaborate with delivery and pre-sales teams to ensure proposed solutions align with client requirements. Working with Marketing and Business Development personnel to help develop lead generation campaigns along with target marketing to specific verticals. · Manage the entire sales cycle, including prospecting, negotiations, and contracting Develop and nurture a robust pipeline of prospects to achieve and exceed sales targets Leverage your sales knowledge and existing Microsoft ecosystem network Qualifications: Minimum of 5 years of experience in selling enterprise software solutions, preferably in the ERP domain Strong knowledge of Microsoft Dynamics 365 Finance & Operations or other ERP systems and their business benefits Excellent communication, presentation, and negotiation skills Ability to work independently and as part of a team in a fast-paced and dynamic environment. Bachelor's degree in business, finance, or related field Prior consulting services sales experience required, and an understanding of Microsoft's Business Applications preferred (Sales, Service, Marketing, Finance, HR, Supply Chain, and Project Operations) Package Details Contract W2 role for an experienced Tech Seller! Base Salary (Draw) W2 Commissioned: from 1-3% on lifetime Support + Bonus on Managed Services +Cash Bonus What's in it for you Qualified Leads Technical Sales & Service Support Product Selling Training Provided Dynamics 365 - CRM Dynamics 365 - Business Central Microsoft 365 ISV Solutions (Offers) Neural Impact Sales Optimization Training Differentiation & Engagement Effective Discovery & CIO Engagement Project Impact & Objection Handling $ 150,000.00 (US Dollar) BIzzApp Sales 2. Acct exec 3. services & support consult

Job DescriptionBusiness Development - Commercial HVAC (Union Market) Company: Quaker Mechanical Employment Type: Independent Contractor (1099) - Commission OnlyAbout Us Quaker Mechanical is a leading commercial HVAC contractor specializing in union projects. With a reputation for excellence, we deliver top-tier mechanical solutions in the union HVAC marketplace across the Cinnaminson area and beyond. Position Overview We're seeking a driven Business Development professional with a solid background in commercial construction sales within the union HVAC market. This is a 1099, commission- only opportunity designed for self-starting individuals eager to grow their income based on performance. Key Responsibilities Cultivate and maintain relationships with general contractors, developers, and union contacts. Identify and pursue new project opportunities in commercial HVAC. Negotiate and close deals aligned with company capacity and goals. Collaborate with internal teams (estimating, operations) to transition new projects smoothly. Provide market insights and strategic growth recommendations. Qualifications 2+ years of experience in commercial construction sales, with a focus on union HVAC. Familiarity with the union HVAC landscape and strong industry contacts. Excellent negotiation, communication, and relationship-building skills. Ability to work independently in a commission-based, 1099 role. Compensation Structure (Commission + Stipends) This role offers uncapped earning potential through a tiered commission on gross profit, plus fixed monthly stipends: 0.5% on $0 - $100,000 Contract amount 1.0% on $101,000 - $500,000 Contract amount 1.5% on $501,000 - $750,000 Contract amount 2.0% on $751,000 and above Contract amount $100/month cell phone stipend $300/month auto stipend

Join Our Team at Litera: Where Legal Technology Meets Excellence Litera has been at the forefront of legal technology innovation for over 25 years, crafting legal software to amplify impact and maximize efficiency. Developed by the best legal minds in the industry, our comprehensive suite of integrated legal tools is both powerful and user-friendly and simplifies the way modern firms manage core legal workflows, secure collaboration, and organize firm knowledge and experience. Every day, we help more than 2.3 million legal professionals focus on their craft. Litera: Less busy work, more of your life's work. Overview: As a Corporate Account Executive at Litera, you will be part of a dynamic team that is passionate about driving innovation in the legal technology space. You will have the opportunity to work with cutting-edge tools and collaborate with industry experts to deliver solutions that make a real difference in the legal profession. Key Responsibilities: * Attain monthly and quarterly sales targets * Earn credibility as a trusted advisor for key contacts within each customer in your territory * Actively listen, understand customer objectives, and articulate relevant technology and business trends and benefits * Develop detailed territory and account plans by working cross-functionally * Expand relationships and grow our partnership within each customer * Prospect into current customer accounts for cross-sell opportunities Qualifications: * You have sold SaaS to law firm, legal, and/or equivalent personas * 5+ years of sales career progression * You have demonstrable success in hitting and exceeding sales quotas * You are energized by navigating complex organizations and decision-making processes * You quickly learn and evangelize technology solutions to challenging business problems * You are keen on organization, collaboration, and getting things done * Comfortable with a quickly changing environment * Thrive on open transparency, communication, and collaboration internally and externally * Competency with Salesforce, Excel, Teams, PowerPoint Why Join Litera? * The company culture: We emphasize helping each other grow, doing the right thing always, and being part of a journey to amplify impact, creating an exciting and fulfilling work environment * Commitment to Employees: Our people commitment is based on what employees love most about being part of the team, focusing on tools that matter to the difference-makers in the legal world and amplifying their impact * Global, Dynamic, and Diverse Team: Our is a global company with ambitious goals and unlimited opportunities, offering a dynamic and diverse work environment where employees can grow, listen, empathize, and problem-solve together * Comprehensive Benefits Package: Experience peace of mind with our health insurance, retirement savings plans, generous paid time off, and a supportive work-life balance. We invest in your well-being and future, ensuring a rewarding career journey. * Career Growth and Development: We provide career paths and opportunities for professional development, allowing employees to progress through various technical and leadership roles Pay Transparency Notice for New Jersey Applicants: The annual salary range for this position is $100,000 to $125,000 with an OTE of $200k to $250k. Actual compensation is determined by factors including education, work experience, certifications, and other relevant qualifications. Litera offers a comprehensive benefits package including health, dental, and vision insurance, 401(k) with company contribution, and incentive and recognition programs. All benefits are subject to eligibility requirements. Litera is an equal opportunity employer. We celebrate diversity and are committed to creating an inclusive environment for all employees.

Toast is driven by building the restaurant platform that helps restaurants adapt, take control, and get back to what they do best: building the businesses they love. As a Territory Sales Account Executive, you will be part of a team that is transforming the way restaurants operate. Using a consultative approach, you will prospect, build relationships, and sign up new restaurateurs in your local area. By understanding their unique needs, you will develop a customized solution that helps their business thrive. We need your passion and expertise to help us build the Toast brand in your geographic territory. This is a field sales opportunity based out of a personal home office. You must live local to your territory or be willing to relocate to the area. About this roll*: (Responsibilities) Generate list of prospective restaurants and manage the entire sales cycle from initial call to close Conduct demos and develop a solution that best meets the prospect's needs Partner with teams across the business to ensure that expectations set during the sales process are met in delivery Leverage Salesforce (our CRM) to manage all sales activities Understand the competitive landscape and determine how to best position Toast in the market Do you have the right ingredients*? (Requirements) 1+ years of experience in a sourcing or closing sales role, restaurant operations, or a relatable field and industry Since this is a field position, you must have reliable transportation (will reimburse for mileage) Strong communication, organizational and presentation skills with the ability to sell and negotiate at all decision-making levels Proven track record of success in meeting and exceeding goals Ability to work in a fast-paced, entrepreneurial and team environment Self-motivated, creative, and flexible General technical proficiency with software Special Sauce* (Nice to Haves) Experience with Salesforce CRM Sandler Sales Training AI at Toast At Toast we're Hungry to Build and Learn. We believe learning new AI tools empowers us to build for our customers faster, more independently, and with higher quality. We provide these tools across all disciplines, from Engineering and Product to Sales and Support, and are inspired by how our Toasters are already driving real value with them. The people who thrive here are those who embrace changes that let us build more for our customers; it's a core part of our culture. Our Spread* of Total Rewards We strive to provide competitive compensation and benefits programs that help to attract, retain, and motivate the best and brightest people in our industry. Our total rewards package goes beyond great earnings potential and provides the means to a healthy lifestyle with the flexibility to meet Toasters' changing needs. Learn more about our benefits at ******************************************** *Bread puns encouraged but not required The estimated Total Targeted Cash compensation range for this role is listed below. Total Targeted Cash for this role consists of a base salary, commission, benefits, and equity (if eligible). This role qualifies for uncapped commissions. The starting salary will be determined based on skills, experience, and geographic location. Total Targeted Cash$129,000-$206,000 USD Diversity, Equity, and Inclusion is Baked into our Recipe for Success At Toast, our employees are our secret ingredient-when they thrive, we thrive. The restaurant industry is one of the most diverse, and we embrace that diversity with authenticity, inclusivity, respect, and humility. By embedding these principles into our culture and design, we create equitable opportunities for all and raise the bar in delivering exceptional experiences. We Thrive Together We embrace a hybrid work model that fosters in-person collaboration while valuing individual needs. Our goal is to build a strong culture of connection as we work together to empower the restaurant community. To learn more about how we work globally and regionally, check out: ********************************************* Apply today! Toast is committed to creating an accessible and inclusive hiring process. As part of this commitment, we strive to provide reasonable accommodations for persons with disabilities to enable them to access the hiring process. If you need an accommodation to access the job application or interview process, please contact candidateaccommodations@toasttab.com. ------ For roles in the United States, It is unlawful in Massachusetts to require or administer a lie detector test as a condition of employment or continued employment. An employer who violates this law shall be subject to criminal penalties and civil liability.

CORE is currently seeking a hardworking and experienced Title Insurance Sales Representative. Join one of South Jersey's fastest growing title companies and most successful title team! Whether you have a well-established client base or need help taking your business to the next level, we want to meet. Increase overall resale and refinance market share in the New Jersey and Pennsylvania market by building strong relationships with REALTORS, mortgage brokers and loan originators, banks, credit unions. Team player who acts as the liaison between the inside office staff and clients in the field. Must be confident in making cold calls, prospecting for leads, as well as maintaining current customer's needs. Strong social media presence is a plus. Develop and initiate new sales and marketing ideas. Actively pursue office presentations with office brokers and staff Knowledge of real estate business is extremely helpful. Consistently increase business and revenues Candidate must possess the following: Strong work ethic. Must provide own reliable transportation. Superior time management skills OTHER REQUIREMENTS: Attending outside functions both during the day and some evenings Excellent interpersonal communication skills (both written and verbal) Ability to effectively present information one-on-one and in group settings Maintain a professional appearance and providing a positive company image EDUCATION: Minimum High School or equivalent (required) Degree in Sales and Marketing (preferred) EXPERIENCE: 2-5 years of successful sales experience in the Real Estate industry Salary is commensurate with experience Job Type: Full-time

Job DescriptionSalary: Gras Lawn, a commercial landscape company, is seeking an experienced Landscape Business Developer for the South Jersey Market. Your main responsibility is developing business with potential new customers, building and maintaining trusted relationships with key decision-makers, understanding their challenges, and creating value solutions. Your role also involves effectively identifying opportunities, gathering valuable intelligence, creating customer-centric proposals, collaborating with team members, meeting specific activity targets, and closing deals. The Business Developer focuses on strengthening Gras Lawns market presence and driving profitable growth. This position plays a key role in meeting long-term strategic objectives by fostering important customer relationships, identifying business opportunities, negotiating and closing deals, and maintaining a comprehensive understanding of the current market landscape. Identifyandunderstandthechallengesofprospectiveclientsanddevelopsolutions. Provideaccurateforecastsforsales,deliverables,andkeyperformanceindicators(KPIs). Achievesalesgoalswhilehavingtheabilitytoworkindependently. Usesalestechniquestofindnewcustomersandbuildlong-termbusinessrelationships.Also,focusonmarketingandpricingstrategies. Conductphoneprospecting,salespresentations,virtualdemonstrations,andcontractnegotiationswithminimalsupervision. Identifycustomerneedsandapplysolution-basedsellingtechniquestodemonstratethevalueof GrasLawnsserviceseffectively. Buildandnurturerelationshipswithpotentialandcurrentclients. Planyourdailyactivitiesandaimtomeetspecificperformancebenchmarkstoclosebusinessdealssuccessfully. ConsistentlyandreliablylogactivitiesintheCRM. Workeffectivelyinafast-pacedenvironmentwhilemaintainingastrongsenseofurgency. Communicateproactivelywithallclients,prospects,andcolleagues. SkillsRequired: ExtensiveexperienceintheCommercialLandscapeIndustry Proventrackrecordofsalesgoalattainmentandpipelinemanagement 3-5yearsofexperienceinB2Bsalesatmid-to-seniorlevels. Localknowledgeandcontactsinoneormoremarketsegments Proficientwithcomputerprograms,including AspireandaCRMtool Highlycompetitive,positive,andresults-driven Exceptionalmultitasker. Excellentoralandwrittencommunicationabilities,strongpresentationskills,andprofessionalexperiencewithsocialmedia. Passionate,organized,andresourcefulindividualwithoutstandinglisteningandinterpersonalskills. Highly organized, self-motivated, and hardworking, with effective time management capabilities. Easilyadaptabletonewsituations. Salary commensurate with experience. Youwillberesponsiblefor: TheBusinessDeveloperoverseesthesalespipelinefromtheprospectingstagetoclosingandisaccountablefortheentiresalescycle,includingsnowsalesincertainregions.Additionally,the BusinessDeveloperworksincollaborationwithpartnersacrossoperations,finance,marketing,andotherdepartmentstoeffectivelyrespondtobidsandachievesalesgoals. Salary commensurate with experience.

Job Description No Experience Necessary!! We will train motivated individuals. A Unique opportunity to make once in a lifetime money right here in New Jersey! Bathroom Pros is growing its local operation. Our top earners in the organization can earn north of 200 K per year. Our first-year representatives can earn between 100k and 180k per year. We are not looking for experienced home-improvement salespeople. We are willing to train the right candidates for this incredible opportunity. Sales experience is a plus but not required. Bathroom Pros is locally owned and operated in Toms River, New Jersey but we sell and install Bathrooms in all areas of New Jersey. It's no accident that we've become one of the most trusted bathroom remodelers in New Jersey. We've FIRMLY adhered to a set of customer-focused Core Values since the day we opened. And the result has been over-the-moon homeowners throughout the Garden State. We sell bathroom remodeling to people that need it! Our customers range from elderly folks looking for safe and accessible bathing to first time homeowners needing to remodel an outdated bathroom. We sell a unique product line made exclusively right here in the USA, by hard-working Americans. We provide preset appointments from our expert marketing team. There is no door knocking or canvassing. You will get qualified leads to run. Successful candidates will be money motivated, driven and extremely hard-working. This is not a job for the faint of heart. You will have to work, and sometimes pretty hard. Some pretty long days too. But you will make more Money than you've ever dreamed. Stop waiting and get your résumé over to us now. ************ (Must be able to pass background check) Job Type: Full-time Pay: $100,000.00 - $180,344.00 per year Powered by JazzHR 7pa1YQT1TQ

Job Description is fully on-site in Cherry Hill, NJ. Local candidates are encouraged to apply.** Here at Brightlane, Inc., we are looking for motivated and competitive individuals for our Entry-Level Sales and Marketing team. In this role, you will drive sales growth through direct customer interaction, building strong relationships, and developing strategies to outperform competitors! Job Responsibilities: Meet and exceed sales goals through consistently Develop and maintain strong relationships with clients, ensuring high levels of customer satisfaction Active networking and lead generation Work closely with our sales and marketing team to refine strategies to increase revenue Track sales activities with transparency and accuracy Qualifications: Strong communication, negotiation, and interpersonal skills. A competitive mindset with a desire for success. Ability to work independently. High school Diploma or equivalent. What We Offer: Competitive base pay and uncapped commissions. Paid training structure Travel opportunities Mentorship with career development Apply NOW for immediate consideration!

Are you ambitious, self-driven, and thrive in a team environment? Do you want a successful career with growth and potential for leadership? Here at Solar pros, we are looking for talented professionals with an entrepreneurial mindset who want to build their career and income to the next level! We're looking for individuals eager to learn and grow in the solar industry, as we guide you to reach your full potential. Our ideal candidate is self-driven, enjoys working with others, and is passionate about mastering the various aspects of solar energy. Opportunities For Advancement As a full-time Sales and Marketing Representative, we are preparing you to succeed in more than just the position you are hired into. We combine training with hands-on sales experience led by the top performers in the industry. We make it a top priority to provide the best training as you begin your career, and throughout your career here with us. Apply now if you are looking to position yourself in a high growth, world changing career! Responsibilities: Provide exceptional customer service face to face with potential homeowners Build strong relationships with customers, teammates and clients Speak with customers regarding solar energy and generate awareness and interest on products and services Cross departmental collaboration and training Requirements: Positive attitude and strong work ethic Student mentality Passion for building relationships Excellent communication skills Availability to work Saturday Benefits: Development and training in a rapidly growing industry Strong leadership that is dedicated to sales support Daily Meetings Team nights Varied pay The ability to create your own career path Join our team, where hard work is balanced with play, victories are celebrated, and growth is a constant journey. Together, we're building a brighter, more sustainable future-one solar solution at a time. Job Type: Full-time Pay: $80,000.00 - $100,000.00 per year Schedule: Work schedule: Tuesday- Saturday Monday (optional) Work Location: In person Compensation: $80,000.00 - $100,000.00 per year Unique marketing solutions with unmatched results Many reputable companies choose to work with Kinetic Innovations because we are problem solvers at the highest level. Personal connection is what sales are all about. Our learnings from Kinetic Innovations have taught us one thing: when people help people, everyone wins.

PagerDuty, Inc. (NYSE:PD) is a global leader in digital operations management. Trusted by nearly half of both the Fortune 500 and the Forbes AI 50, as well as approximately two-thirds of the Fortune 100, PagerDuty is essential for delivering always-on digital experiences to modern businesses. Join us. (******************************* At PagerDuty, you'll tackle complex problems, collaborate with kind and ambitious people, and help build a more equitable world-all in a flexible, award-winning workplace. **Overview of the Role:** PagerDuty is seeking a Strategic Account Executive to join our dynamic and customer-focused team! We are looking for a talented sales professional experienced in enterprise, multi-product SaaS software, who will uncover and close PagerDuty product and service opportunities. In this role, you will have the opportunity to drive new business and support our key strategic accounts by embracing PagerDuty's commitment to "Champion the Customer," and you will be responsible for delivering exceptional sales experiences by identifying challenges in customers' environments, and transforming those challenges into business-driven perspectives, while communicating the positive impact of resolving them. This role encompasses the overall success and sales performance of a defined account territory. **How You Impact Our Vision** You will be engaging, influencing, and fostering relationships with individuals at various levels within organizations, including individual contributors, mid-level management, and C-suite executives, to drive their digital transformation strategy with leading enterprise customers. Your role will involve: + Leading a cross-functional account team in developing and implementing detailed account plans/strategies to expand existing relationships and acquire new customers. This involves collaborating with teams such as Marketing, Solution Consulting, Customer Success, Business Value, BDRs, and Strategic Alliance teams. + Maintaining a keen focus on identifying challenges in customers' environments and developing a business-oriented perspective that motivates them to take action in addressing those challenges. + Generating revenue by selling, managing, and cultivating existing client relationships, and by selling to greenfield accounts. + Continuously connecting the dots within your account base to establish executive alignments, foster broad relationships, and engage with targeted teams and leadership. + Demonstrating the ability to navigate a hybrid business approach that combines a frictionless, transactional sales model with a strategic, large deal selling motion, depending on the situation. + Prioritizing opportunities and coordinating with your internal team to provide exceptional customer experiences and ensure 100% satisfaction. + Exceeding monthly, quarterly, and annual quotas. + Utilizing our sales methodology and processes effectively for lead management and sales forecasting. + Committing to pipeline generation and conducting thorough account research. **Basic Qualifications:** + At least 7 years of outside software sales experience, which includes 3 years of experience selling at Strategic and/or Enterprise in a multi-product, complex software environment (SaaS, IT infrastructure or similar industries preferred) + Able to demonstrate methodology to prospect and build pipeline independently and a demonstrated track record of hitting and exceeding sales targets + Experience leading large and complex sales cycles within Global 2000 Enterprises, with the ability to understand customers' needs and translate them into tailored solutions + Strong presentation, verbal, and written communication skills **Preferred Qualifications:** + Advanced knowledge around DevOps, IT Ops and Platform Engineering + Familiarity with MEDDICC and Command of the Message + Strong technical expertise, understanding of engineering culture, and the ability to connect with customers + Bachelor's Degree or higher is preferable The base salary range for this position is 160,000 - 185,000 USD (50/50 split). This role may also be eligible for bonus, commission, equity, and/or benefits. Our base salary ranges are determined by role, level, and location. The range, which is subject to change based on primary work location, reflects the minimum and maximum base salary we expect to pay newly hired employees for the position. Within the range, we determine pay for an individual based on a number of factors including market location, job-related knowledge, skills/competencies and experience. Your recruiter can share more about the specific offerings for this role, as well as the salary range for your primary work location during the hiring process. **Hesitant to apply?** We encourage you to submit your resume even if you don't meet every requirement. We value potential and consider each candidate's full professional story. Whether you're exploring a career change or taking your next step, we look forward to reviewing your application. If this just isn't the right role or time - sign up for job alerts (**************************************** ! **Where we work** PagerDuty operates a hybrid work model with offices (**************************************** in 8 major cities: Atlanta, Lisbon, London, San Francisco, Santiago, Sydney, Tokyo, and Toronto. While we offer flexibility within our established locations, we **cannot** employ candidates residing in: **Location restrictions:** **Australia:** Northern Territory, Queensland, South Australia, Tasmania, Western Australia **Canada:** Alberta, Manitoba, Newfoundland, Northwest Territories, Nunavut, PEI, Quebec, Saskatchewan, Yukon **United States:** Alaska, Hawaii, Iowa, Louisiana, Mississippi, Nebraska, New Mexico, Oklahoma, Rhode Island, South Dakota, West Virginia, Wyoming _Candidates must reside in an eligible location, which vary by role._ **How we work** Our values (************************************** guide how we support customers, collaborate with colleagues, develop products, and foster a culture of belonging. They define not just our actions, but what it means to be Dutonian. People Leaders at PagerDuty are responsible for creating high performance environments that drive accountability. PagerDuty has four key dimensions that define our Leadership Impact: Lead Self, Lead the Team, Lead the Business, and Lead the Future. Each dimension has three associated competencies to give leaders a shared language for guiding their development, career, promotion, and succession planning discussions. Our Manager Expectations serve as a practical guide for managers to understand their responsibilities, prioritize their efforts, and drive engagement and performance. **What we offer** As a global organization, our total rewards approach is competitive with industry standards and aligned with local laws and regulations. Learn more, including country-specific offerings, on our benefits site (********************************************** . **Your package may include:** + Competitive salary + Comprehensive benefits package + Flexible work arrangements + Company equity* + ESPP (Employee Stock Purchase Program)* + Retirement or pension plan* + Generous paid vacation time + Paid holidays and sick leave + Dutonian Wellness Days & HibernationDuty - companywide paid days off in addition to PTO + Paid parental leave: 22 weeks for pregnant parent, 12 weeks for non-pregnant parent (some countries have longer leave standards and we comply with local laws)* + Paid volunteer time off: 20 hours per year + Company-wide hack weeks + Mental wellness programs *Eligibility may vary by role, region, and tenure **About PagerDuty** PagerDuty, Inc. (NYSE:PD) is a global leader in digital operations management. The PagerDuty Operations Cloud is an AI-powered platform that empowers business resilience and drives operational efficiency for enterprises. With a generative AI assistant at its core, PagerDuty empowers teams to detect and resolve issues in real time, orchestrate complex workflows, and drive continuous improvement across their digital operations. Trusted by nearly half of both the Fortune 500 and the Forbes AI 50, as well as approximately two-thirds of the Fortune 100, PagerDuty is essential for delivering always-on digital experiences to modern businesses PagerDuty is Great Place to Work-certified, a Fortune Best Workplace for Millennials, a Fortune Best Medium Workplace, a Fortune Best Workplace in Technology, and a top rated product on TrustRadius and G2. Go behind-the-scenes on our careers site (*********************************** and @pagerduty on Instagram. **Additional Information** PagerDuty is an equal opportunity employer. PagerDuty does not discriminate on the basis of race, religion, color, national origin, gender, sexual orientation, age, marital status, parental status, veteran status, or disability status. Your privacy is important to us. By submitting an application, you confirm that you have read and understand PagerDuty's Privacy Policy (****************************************** . PagerDuty is committed to providing reasonable accommodations for qualified individuals with disabilities in our job application process. Should you require accommodation, please email accommodation@pagerduty.com and we will work with you to meet your accessibility needs. PagerDuty uses the E-Verify employment verification program.

Job DescriptionAre you ambitious, self-driven, and thrive in a team environment? Do you want a successful career with growth and potential for leadership? Here at Solar pros, we are looking for talented professionals with an entrepreneurial mindset who want to build their career and income to the next level! Were looking for individuals eager to learn and grow in the solar industry, as we guide you to reach your full potential. Our ideal candidate is self-driven, enjoys working with others, and is passionate about mastering the various aspects of solar energy. Opportunities For Advancement As a full-time Sales and Marketing Representative, we are preparing you to succeed in more than just the position you are hired into. We combine training with hands-on sales experience led by the top performers in the industry. We make it a top priority to provide the best training as you begin your career, and throughout your career here with us. Apply now if you are looking to position yourself in a high growth, world changing career! Responsibilities: Provide exceptional customer service face to face with potential homeowners Build strong relationships with customers, teammates and clients Speak with customers regarding solar energy and generate awareness and interest on products and services Cross departmental collaboration and training Requirements: Positive attitude and strong work ethic Student mentality Passion for building relationships Excellent communication skills Availability to work Saturday Benefits: Development and training in a rapidly growing industry Strong leadership that is dedicated to sales support Daily Meetings Team nights Varied pay The ability to create your own career path Join our team, where hard work is balanced with play, victories are celebrated, and growth is a constant journey. Together, were building a brighter, more sustainable futureone solar solution at a time. Job Type: Full-time Pay: $80,000.00 - $100,000.00 per year Schedule: Work schedule: Tuesday- Saturday Monday (optional) Work Location: In person