Business advisor jobs in Vineland, NJ - 431 jobs

Gateway Search has an exciting Business Developer opportunity with a dynamic and growing regional consulting firm that delivers high -impact advisory services to middle -market companies across a range of industries. The firm specializes in strategic, financial, and operational consulting-and is known for building lasting client relationships and driving measurable growth. As they continue to expand, they're looking for a results -driven Business Developer to help lead their growth efforts by identifying new client opportunities, cultivating relationships with C -level decision -makers, and effectively positioning the firm's service offerings. Key Highlights of the Role: Lead strategic outreach and relationship -building with prospective and existing clients Develop and execute a sales plan aligned with growth goals Collaborate with consulting teams to create tailored solutions Represent the firm at industry events and networking functions Leverage CRM tools to manage the sales pipeline and provide insights to leadership RequirementsWhat They're Looking For: 5+ years of experience in business development or consultative B2B sales (professional services preferred) Proven track record working with middle -market clients Strong communication, negotiation, and strategic thinking skills Comfortable working independently and cross -functionally Bachelor's degree required; MBA preferred Benefits Vision, Dental, Medical, Flexible Time Off, 401K Experience Level Mid -Level (5-8 yrs) Base Salary: $85,000-$110,000 Bonus/Commission: $20,000-$40,000 Total Compensation: $105,000-$150,000 Senior (8-12 yrs) Base Salary: $110,000-$140,000 Bonus/Commission $30,000-$60,000 Total Compensation: $140,000-$200,000+

Häfele America Co. at a quick glance: We are the largest subsidiary of a privately-held, a global powerhouse in the areas of LED lighting, cabinet and furniture hardware, kitchen organization and much more. We offer a strong benefits package including medical, dental, 401(k) with company match, employee discount and other perks. There's a very good reason 41% of our employees have been with us for over ten years - we hire the best, treat people well and truly provide a family atmosphere that works hard and plays to win. KEY RESPONSIBILITIES include the following. Other duties may be assigned. Defined territory consists of kitchen manufacturers and dealers in Eastern, PA. (Role is based is based in PA) Grow and manage sales within assigned accounts, developing strong relationships across Purchasing, Operations, Marketing, and Leadership. Identify and pursue new business with underdeveloped kitchen manufacturers. Promote Hafele's full product offering, including functional hardware, kitchen organization, fasteners, and lighting. Collaborate with internal teams and dealer networks to ensure aligned efforts and maximize sales opportunities. Communicate regularly with Hafele colleagues on dealer feedback, product needs, and market trends. Present new product launches and act as knowledgeable resource on Hafele's solutions. Participate in team strategy sessions and contribute ideas for growth and improvement. Assist in developing "customer specific products" What We're Looking for: A professional, proactive team player with strong relationship-building and communication skills. Someone who thrives in a collaborative, solution-oriented environment. A representative of Hafele who acts with integrity and understands the value we bring to the kitchen and bath industry. EDUCATION and/or EXPERIENCE Bachelor's degree from four-year College or University. Considerations will be made for additional training programs or equivalent combination of education and experience. This individual must have a degree of applicable market and product knowledge. Position requires high degree of comfort in dealing with various level of decision-makers. COMPUTER SKILLS Proficiency in MS Excel, Outlook, PowerPoint and Word. Experience with Salesforce is a plus.

Are you someone who loves helping people reach their business goals? Are you a great problem solver? If you answered "yes" to these questions, keep reading. The SMB Team is the fastest-growing digital marketing and coaching business for attorneys nationwide and we are looking for a Business Strategist and Advisor to join our Coaching Team! WHAT'S IN IT FOR YOU? 📈 An opportunity to be a part of the #1 Fastest Growing Legal Marketing & Coaching Company in the U.S. 🦷 BENEFITS - We pay for 75% of your Medical, Dental, Vision insurance for YOU and YOUR FAMILY. ☀️ FLEXIBLE VACATION TIME - We encourage you to take time to recharge so you can be your best here at work. 💡 EDUCATION - Team member education and learning budget on courses, events and books. 🌴 FUN - Company activities, outings, and retreats. 💲 INVESTMENTS - 401(k) with a 3% Match. 💻 WORK STYLE - WFH or come to the office. The choice is yours! The salary for this role is $90,000-$95,000 annually. Key Responsibilities: Hold monthly client accountability calls to hold clients accountable to their goals. This may include problem solving, giving advice based on our frameworks, or just listening. Maintain/enforce program standards and frameworks to ensure client success. Execute new program initiatives as they develop. We move quickly and try new things (while maintaining our core systems). If that's not how you like to operate, this probably isn't the role for you. Identify client struggles and offer solutions and services to assist. This could include marketing or virtual assistant services that we offer. Assist with planning and participating in weekly coaching calls and events. This includes weekly group coaching calls, client masterminds when needed, quarterly workshops, and one-off workshops. Requirements 5 - 7 years experience as a successful business coach, with experience holding clients accountable, overseeing a budget, goal setting, KPI tracking, and a history of business growth. A Coaching Accreditation is required. Familiarity with EOS/Traction and/or Scaling-Up strongly preferred. Excellent written and verbal communication skills. We don't expect you to be the next great novelist or public speaker, but we do expect you to be able to effectively communicate information that may not be familiar to our clients. MUST have strong interpersonal skills. We are looking for individuals who can build great relationships with our clients. Proficient with the Google Suite. Solid organization skills so that you can effectively manage your daily, weekly, and monthly to-do list. Ability to thrive in a fast-paced environment and think quickly on your feet in order to adapt to client situations or changes in the company. Proactive and resourceful in all aspects of your role. Coachable Attitude: Must possess the ability to be coached and open to feedback, demonstrating a commitment to personal and professional growth. Collaborative & Adaptable Mindset: Must be a team player who can set aside ego to work effectively with colleagues and clients. Quick Learner: Ability to rapidly grasp new processes and adapt to a fast-paced, innovative environment. Initiative: Willingness to take initiative on tasks, regardless of size, both within the department and for clients. Process Improvement: Eagerness to participate in and collaborate on enhancing internal processes for greater efficiency and effectiveness. Budget Management Experience: Must have managed a budget of at least $2.5M Reading Requirements: If not already familiar with these books, the employee must read them within the first month of employment. Must have read and be familiar with the following books: Scaling Up by Verne Harnish The E-Myth Revisited by Michael E. Gerber Traction by Gino Wickman Good to Great by Jim Collins Law Firm Growth Accelerator by Bill Hauser and Andy Stickel Benefits SMB Team is a rapidly-growing marketing agency and coaching business for lawyers. After four years of 300% year-over-year growth, we have quickly become one of the top brands in the legal industry. Bottom Line: We change lives. Want proof? Read our Google My Business reviews. The SMB Team is an Equal Opportunity Employer. The policy of The SMB Team is to extend opportunities to qualified applicants and employees on an equal basis regardless of an individual's race, color, gender, age, national origin, religion, citizenship status, marital status, sexual orientation, gender identity, transgender status, physical or mental disability, protected veteran status, genetic information, pregnancy, or any other categories protected by applicable federal, state or local laws. The SMB Team is an Equal Opportunity Employer - Minority/Female/Disabled/Protected Veterans

ITC WORLDWIDE is seeking a dynamic and experienced Microsoft Business Applications Senior Sales Consultant WFH or an ITC field office Are you passionate about selling business applications solutions that empower organizations to achieve more? Do you have a proven track record of delivering results in a complex and competitive market? Do you have experience with Microsoft Dynamics 365 Finance & Operations or other ERP systems? If so, we want to hear from you. To be successful in this position you will possess the following attributes: Motivated and proactive professional with previous experience in end-to-end sales within Microsoft or equivalent Enterprise Applications. 5+ years face-to-face selling experience - Microsoft product suite expertise including D365, PowerApps and Business Central is highly regarded. Demonstrated ability to hunt new business opportunities. Ability to build and foster strong customer relationships in existing customer base. A strong customer-centric approach and ability to network across a complex organization. Skills in managing multiple commercial processes (new business sales), forecasting precisely and identifying challenges to positive commercial outcomes. Develop and execute a sales strategy in designated territories and work with both vendor and Industry teams to execute. Arrange and conduct customer meetings, serve as trusted advisor by understanding a customer's existing and future digital transformation roadmap and driving the sales. Strong networking skills and industry experience Ability to drive new business and get engaged with lead generation. Liaising with solution consultants to drive correct business outcomes. Desire to be involved in a rapidly growing business and take a leadership role in helping it thrive. Strong personality motivated by continual improvement and self-development Responsibilities: Develop and execute sales strategies to grow revenue and market share in the Finance & Operations segment. Build and maintain strong relationships with key decision makers and influencers across various industries and geographies. Understand customer needs and pain points and propose value-added solutions that leverage Microsoft's D365 platforms and applications. Collaborate with delivery and pre-sales teams to ensure proposed solutions align with client requirements. Working with Marketing and Business Development personnel to help develop lead generation campaigns along with target marketing to specific verticals. · Manage the entire sales cycle, including prospecting, negotiations, and contracting Develop and nurture a robust pipeline of prospects to achieve and exceed sales targets Leverage your sales knowledge and existing Microsoft ecosystem network Qualifications: Minimum of 5 years of experience in selling enterprise software solutions, preferably in the ERP domain Strong knowledge of Microsoft Dynamics 365 Finance & Operations or other ERP systems and their business benefits Excellent communication, presentation, and negotiation skills Ability to work independently and as part of a team in a fast-paced and dynamic environment. Bachelor's degree in business, finance, or related field Prior consulting services sales experience required, and an understanding of Microsoft's Business Applications preferred (Sales, Service, Marketing, Finance, HR, Supply Chain, and Project Operations) Package Details Contract W2 role for an experienced Tech Seller! Base Salary (Draw) W2 Commissioned: from 1-3% on lifetime Support + Bonus on Managed Services +Cash Bonus What's in it for you Qualified Leads Technical Sales & Service Support Product Selling Training Provided Dynamics 365 - CRM Dynamics 365 - Business Central Microsoft 365 ISV Solutions (Offers) Neural Impact Sales Optimization Training Differentiation & Engagement Effective Discovery & CIO Engagement Project Impact & Objection Handling $ 150,000.00 (US Dollar) BIzzApp Sales 2. Acct exec 3. services & support consult

Hours: 40 Pay Details: $95,264 - $155,376 USD TD is committed to providing fair and equitable compensation opportunities to all colleagues. Growth opportunities and skill development are defining features of the colleague experience at TD. Our compensation policies and practices have been designed to allow colleagues to progress through the salary range over time as they progress in their role. The base pay actually offered may vary based upon the candidate's skills and experience, job-related knowledge, geographic location, and other specific business and organizational needs. As a candidate, you are encouraged to ask compensation related questions and have an open dialogue with your recruiter who can provide you more specific details for this role. Line of Business: Analytics, Insights, & Artificial Intelligence Job Description: Job Summary: The Business Insights Specialist is responsible for conducting analyses on curated and/or aggregated DataMart's in conjunction with deep business subject matter expertise, to generate relevant analytical insights for business issues and identify opportunities to drive business growth and value. This role works in partnership with business leaders to present or generate appropriate insights including the delivery of supporting collateral and/or presentations. Depth & Scope: Works autonomously and accountable for acting as a lead within a specialized business management function and may provide work direction to others Provides seasoned specialized knowledge, advice and/or guidance to various stakeholders and team members Scope of role may have enterprise impact Focuses on short to medium - term issues (e.g. 6-12 months) Undertakes and completes a variety of complex projects and initiatives requiring specialist knowledge and/or the integration of cross functional processes within own area of expertise Oversees and/or independently performs tasks from end-to-end May interact with any hierarchy level up to executive leaders and external vendors Education & Experience: Undergraduate degree or advanced technical degree preferred (e.g., math, physics, engineering, finance or computer science) Graduate's degree preferred with either progressive project work experience, or; 5+ year of relevant experience; higher degree education and research tenure can be counted Customer Accountabilities: Leads on the interpretation of complex business issues, generates multifaceted insights and identifies opportunities to help drive business growth or address business/enterprise needs Presents and communicates generated insights and recommended business actions to stakeholders/business leaders in an easily digestible manner, leveraging tools/techniques/methods to produce a variety of visualizations/presentations that fit the audience Acts as the primary interface with business to bridge and translate business requirements to analytics and reporting needs for a given domain/business Applies collaborative and strong stakeholder management approach to constructively influence and persuade stakeholders and partners where appropriate Serves as an authority on a given business domain and provides business expertise to place context around analytics discovery and inform recommendations Escalates data/process related problems and communicates to relevant teams in a timely manner and makes recommendations for resolution Provides day-to-day support and delivery of analytics Shareholder Accountabilities: Represents functional area as a business insights & analytics specialized expert Synthesizes complex and vast amount of information and translates into actionable insights and strategy Builds business requirements and facilitates project execution to develop insights Collaborates with partners on business challenges and delivers fact-based analytical advice that aligns to strategy and drives shareholder value Identifies opportunities for business growth within a specific business or function by identifying potential use cases and value drivers Utilizes both quantitative and qualitative methodologies to interpret and present data effectively and clearly Works directly with the business teams to gather the demand for analytics and work with the analytics hub to fulfill the analytics demand Provides business explanation for anomalies/outliers identified during analysis Works with business functions and analytics teams to transition business requirements to analytics requirements Trains business users on how to integrate analytics into decisions Leverages knowledge of data capabilities to build and deliver insights Develops analysis to corroborate initial proof of concept Executes on data requests accurately and within a timely manner Identifies and investigates data/analytics related issues Ensures business operations are in compliance with applicable internal and external requirements (e.g. financial controls, segregation of duties, transaction approvals and physical control of assets) Leads/facilitates and/or implements action/remediation plans to address performance/risk/governance issues Actively manages relationships within and across various business lines, corporate and/or control functions and ensures alignment with enterprise and/or regulatory requirements Keeps abreast of emerging issues, trends, and evolving regulatory requirements and assesses potential impacts Maintains a culture of risk management and control, supported by effective processes in alignment with risk appetite Employee/Team Accountabilities: Participates fully as a member of the team, supports a positive work environment that promotes service to the business, quality, innovation and teamwork and ensures timely communication of issues/points of interest Provides thought leadership and/or industry knowledge for own area of expertise in own area and participates in knowledge transfer within the team and business unit Keeps current on emerging trends/developments and grows knowledge of the business, related tools and techniques Participates in personal performance management and development activities, including cross training within own team Keeps others informed and up to date about the status/progress of projects and/or all relevant or useful information related to day-to-day activities Contributes to team development of skills and capabilities through mentorship of others, by sharing knowledge and experiences and leveraging best practices Leads, motivates and develops relationships with internal and external business partners/stakeholders to develop productive working relationships Contributes to a fair, positive and equitable environment that supports a diverse workforce Acts as a brand ambassador for your business area/function and the bank, both internally and/or externally Physical Requirements: Never: 0%; Occasional: 1-33%; Frequent: 34-66%; Continuous: 67-100% Domestic Travel - Occasional International Travel - Never Performing sedentary work - Continuous Performing multiple tasks - Continuous Operating standard office equipment - Continuous Responding quickly to sounds - Occasional Sitting - Continuous Standing - Occasional Walking - Occasional Moving safely in confined spaces - Occasional Lifting/Carrying (under 25 lbs.) - Occasional Lifting/Carrying (over 25 lbs.) - Never Squatting - Occasional Bending - Occasional Kneeling - Never Crawling - Never Climbing - Never Reaching overhead - Never Reaching forward - Occasional Pushing - Never Pulling - Never Twisting - Never Concentrating for long periods of time - Continuous Applying common sense to deal with problems involving standardized situations - Continuous Reading, writing and comprehending instructions - Continuous Adding, subtracting, multiplying and dividing - Continuous The above statements are intended to describe the general nature and level of work being performed by people assigned to this job. They are not intended to be an exhaustive list of all responsibilities, duties and skills required. The listed or specified responsibilities & duties are considered essential functions for ADA purposes. Who We Are: TD is one of the world's leading global financial institutions and is the fifth largest bank in North America by branches/stores. Every day, we deliver legendary customer experiences to over 27 million households and businesses in Canada, the United States and around the world. More than 95,000 TD colleagues bring their skills, talent, and creativity to the Bank, those we serve, and the economies we support. We are guided by our vision to Be the Better Bank and our purpose to enrich the lives of our customers, communities and colleagues. TD is deeply committed to being a leader in customer experience, that is why we believe that all colleagues, no matter where they work, are customer facing. As we build our business and deliver on our strategy, we are innovating to enhance the customer experience and build capabilities to shape the future of banking. Whether you've got years of banking experience or are just starting your career in financial services, we can help you realize your potential. Through regular leadership and development conversations to mentorship and training programs, we're here to support you towards your goals. As an organization, we keep growing - and so will you. Our Total Rewards Package Our Total Rewards package reflects the investments we make in our colleagues to help them and their families achieve their financial, physical and mental well-being goals. Total Rewards at TD includes base salary and variable compensation/incentive awards (e.g., eligibility for cash and/or equity incentive awards, generally through participation in an incentive plan) and several other key plans such as health and well-being benefits, savings and retirement programs, paid time off (including Vacation PTO, Flex PTO, and Holiday PTO), banking benefits and discounts, career development, and reward and recognition. Learn more Additional Information: We're delighted that you're considering building a career with TD. Through regular development conversations, training programs, and a competitive benefits plan, we're committed to providing the support our colleagues need to thrive both at work and at home. Colleague Development If you're interested in a specific career path or are looking to build certain skills, we want to help you succeed. You'll have regular career, development, and performance conversations with your manager, as well as access to an online learning platform and a variety of mentoring programs to help you unlock future opportunities. Whether you have a passion for helping customers and want to expand your experience, or you want to coach and inspire your colleagues, there are many different career paths within our organization at TD - and we're committed to helping you identify opportunities that support your goals. Training & Onboarding We will provide training and onboarding sessions to ensure that you've got everything you need to succeed in your new role. Interview Process We'll reach out to candidates of interest to schedule an interview. We do our best to communicate outcomes to all applicants by email or phone call. Accommodation TD Bank is an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, age, disability, status as a protected veteran or any other characteristic protected under applicable federal, state, or local law. If you are an applicant with a disability and need accommodations to complete the application process, please email TD Bank US Workplace Accommodations Program at ***************. Include your full name, best way to reach you and the accommodation needed to assist you with the applicant process.

. Must be willing to travel, with overnight hotel stays, up to 5 nights per week (every week). Reynolds and Reynolds is looking for experienced automotive professionals to join our consulting team. Our superior software solutions, our award-winning sales, service, and support have made us one of the most recognized and respected companies in the automotive industry. As an Automotive Business Consultant your primary focus will be to establish professional relationships with customers and help their businesses become more efficient, effective, and profitable. You will work with dealership personnel to identify trouble areas within the dealership and then use established and proven consulting services programs, as well as your industry knowledge, to help solve these issues. Once a project is complete, you will follow-up with customers to maintain relationships and provide ongoing 'fee for service' support and problem resolution. By helping these customers become successful in the different areas of the dealership, you will build trust that will further drive consulting services sales. If you are looking for an opportunity to utilize your automotive skills and make a difference for automotive dealerships across the country, please apply today!","job_category":"Consulting","job_state":"PA","job_title":"Automotive Business Consultant - Accounting Specialist","date":"2026-01-04","zip":"19019","position_type":"Full-Time","salary_max":"80,000. 00","salary_min":"60,000. 00","requirements":"High School Diploma or equivalent; Bachelor's preferred but not required~^~5+ years of automotive dealership experience (Office Manager, controller(automotive accounting), and AP\/AR Accounting Representative)~^~Must be willing to travel extensively with overnight hotel stays up to 5 nights per week (every week). ~^~Must have reliable transportation as well as a valid driver's license, with fewer than 2 moving violations in the last three years and no OVI\/DUI\/DWI violations in the last five years. ~^~Must have reliable home internet with sufficient bandwidth for video conferencing~^~Experience with Reynolds and Reynolds accounting software is highly preferred","training":"Our training consists of time with experienced consulting and sales representatives in the field for approximately 90 days, online courses completed in your home office, and classroom instruction through our offices in Dayton and Houston. Your compensation during training will be a $60,000-63,000 base salary. You will be eligible for quarterly bonuses after the 9 month training period. Total targeted income after training (including base and bonuses) is $80,000+. ","benefits":"We strive to offer an environment that provides our associates with the right balance between work and family. We offer a comprehensive benefits package including: - Medical, dental, vision, life insurance, and a health savings account - 401(k) with up to 6% matching - Paid vacation and sick days - Eight paid holidays - Referral bonuses - Professional development and training - Promotion from within Reynolds and Reynolds promotes a healthy lifestyle by providing a non-smoking environment. Reynolds and Reynolds is an equal opportunity employer. ","

Job Description Alcott HR is seeking an experienced Outside Sales professional to join our team as a Senior Business Consultant. As a Professional Employer Organization, we offer comprehensive Human Resources support to our clients. In this role, you will spearhead the launch of our services in the Philadelphia market, serving as the primary sales representative. Your main responsibilities will include identifying potential business opportunities, fostering strong relationships throughout the area, and engaging with potential clients to understand their needs. You will work closely with business owners and key decision-makers to provide tailored HR solutions. We've got a lot to offer: Uncapped commission and unlimited territory Ability to sell any of our offerings to any industry (PEO, ASO, HRO, HR Consulting) Competitive base salary plus an industry-leading commission plan with escalating rates Remote schedule Here's what you'll do: Develop and maintain relationships with business owners and key decision makers. Leverage your professional network to generate referral business and expand Alcott HR's client base Network with business advisors to educate them on Alcott HR's offerings and benefits for their clients Prospect and network for business owners and key decision makers to explain how Alcott HR can help their company to grow Complete required sales process, paperwork and finalize new client contracts Travel throughout our open territory. No set territories with Alcott HR! Exceed sales goals determined by management, and reach your maximum earning potential You are someone who has: 2+ years of business-to-business sales experience with a focus on relationship-building Successful and stable track record of excellence Ability to aggressively prospect for new business A positive and consultative mindset when engaging with clients Exceptional verbal and written communication abilities, particularly with C-level executives Ability to work independently, as well as being a collaborative team member Expertise in consultative and solution-oriented sales techniques A driven, self-starter attitude with strong time management skills We definitely want to talk to you if you have the following: Demonstrated ability in cold calling and prospecting with a positive and persistent style Proven ability to be a "hunter gatherer" within the C-level market PEO and/or Employee Benefit sales experience We know you have your choice of roles for your next opportunity. Here's why we think you should choose Alcott HR: You'll be joining a PEO & HR company that is poised for rapid growth, taking a new and exciting service model and message to underserved markets across the US. We have a big market to go after, striving to provide the best and most unique HR service in the space, and some of the most loyal and enthusiastic clients behind us. Big Enough to Get the Job Done, Small Enough to Care. Family working environment with the ability to influence executive decision making and help steer the ship. Compensation: Base Salary of $70,000-$85,000 plus commission structure, enabling a potential total earning potential of $105,000-$185,000+ About Alcott HR At Alcott HR, we have a Passion for People and Performance™. We empower leaders to focus on their core business purposes and meaning which enables them to more quickly and efficiently grow their business. Alcott HR provides clients and business owners with customized solutions for running their business, including HR best practices, regulatory compliance, payroll, training and development, employee benefits, risk management support, workers' compensation insurance and employment related administration. We serve a diverse group of successful profit and not for profit businesses across the U.S. Get to know us by visiting ***************** Alcott HR provides equal employment opportunities (EEO) to all employees and applicants for employment without regard to race, color, religion, sex, national origin, age, disability or genetics. In addition to federal law requirements, Alcott HR complies with applicable state and local laws governing nondiscrimination in employment in every location in which the company has facilities.

Job DescriptionBusiness Development - Commercial HVAC (Union Market) Company: Quaker Mechanical Employment Type: Independent Contractor (1099) - Commission OnlyAbout Us Quaker Mechanical is a leading commercial HVAC contractor specializing in union projects. With a reputation for excellence, we deliver top-tier mechanical solutions in the union HVAC marketplace across the Cinnaminson area and beyond. Position Overview We're seeking a driven Business Development professional with a solid background in commercial construction sales within the union HVAC market. This is a 1099, commission- only opportunity designed for self-starting individuals eager to grow their income based on performance. Key Responsibilities Cultivate and maintain relationships with general contractors, developers, and union contacts. Identify and pursue new project opportunities in commercial HVAC. Negotiate and close deals aligned with company capacity and goals. Collaborate with internal teams (estimating, operations) to transition new projects smoothly. Provide market insights and strategic growth recommendations. Qualifications 2+ years of experience in commercial construction sales, with a focus on union HVAC. Familiarity with the union HVAC landscape and strong industry contacts. Excellent negotiation, communication, and relationship-building skills. Ability to work independently in a commission-based, 1099 role. Compensation Structure (Commission + Stipends) This role offers uncapped earning potential through a tiered commission on gross profit, plus fixed monthly stipends: 0.5% on $0 - $100,000 Contract amount 1.0% on $101,000 - $500,000 Contract amount 1.5% on $501,000 - $750,000 Contract amount 2.0% on $751,000 and above Contract amount $100/month cell phone stipend $300/month auto stipend

CORE is currently seeking a hardworking and experienced Title Insurance Sales Representative. Join one of South Jersey's fastest growing title companies and most successful title team! Whether you have a well-established client base or need help taking your business to the next level, we want to meet. Increase overall resale and refinance market share in the New Jersey and Pennsylvania market by building strong relationships with REALTORS, mortgage brokers and loan originators, banks, credit unions. Team player who acts as the liaison between the inside office staff and clients in the field. Must be confident in making cold calls, prospecting for leads, as well as maintaining current customer's needs. Strong social media presence is a plus. Develop and initiate new sales and marketing ideas. Actively pursue office presentations with office brokers and staff Knowledge of real estate business is extremely helpful. Consistently increase business and revenues Candidate must possess the following: Strong work ethic. Must provide own reliable transportation. Superior time management skills OTHER REQUIREMENTS: Attending outside functions both during the day and some evenings Excellent interpersonal communication skills (both written and verbal) Ability to effectively present information one-on-one and in group settings Maintain a professional appearance and providing a positive company image EDUCATION: Minimum High School or equivalent (required) Degree in Sales and Marketing (preferred) EXPERIENCE: 2-5 years of successful sales experience in the Real Estate industry Salary is commensurate with experience Job Type: Full-time

Job Description Our client, a growing, privately owned, Light Industrial Staffing services, in New jersey is looking for a Business Development professional to join their team. This role will focus on bringing in new Light Industrial business in the Southern, NJ, Philly, and Northern Delaware market. Most of this position is field based and Friday's are spent in their Southern New Jersey office Responsibilities include; Prospecting new business by phone, email, social media, and in-person Meeting new clients within an assigned territory (with no internal competition) nts. Using Salesforce to document sales activity, meetings, follow ups etc. Contract negotiations. Reach agreed upon monthly sales targets. YOU might be the right person if YOU have: Previous light industrial temporary staffing sales experience or recruiting experience. Outside B2B sales experience selling into the light industrial space Strong closing abilities. Strong sense or urgency Attention to detail. Our client offers a competitive base salary, commission, car allowance, phone and benefits Master Search Solutions is a direct hire recruiting firm that specializes in the New Jersey marketplace. We have nearly 30 years of experience connecting top talent with leading businesses. We are committed to (and celebrate) diversity, equity, and inclusion.

Job DescriptionSalary: Gras Lawn, a commercial landscape company, is seeking an experienced Landscape Business Developer for the South Jersey Market. Your main responsibility is developing business with potential new customers, building and maintaining trusted relationships with key decision-makers, understanding their challenges, and creating value solutions. Your role also involves effectively identifying opportunities, gathering valuable intelligence, creating customer-centric proposals, collaborating with team members, meeting specific activity targets, and closing deals. The Business Developer focuses on strengthening Gras Lawns market presence and driving profitable growth. This position plays a key role in meeting long-term strategic objectives by fostering important customer relationships, identifying business opportunities, negotiating and closing deals, and maintaining a comprehensive understanding of the current market landscape. Identifyandunderstandthechallengesofprospectiveclientsanddevelopsolutions. Provideaccurateforecastsforsales,deliverables,andkeyperformanceindicators(KPIs). Achievesalesgoalswhilehavingtheabilitytoworkindependently. Usesalestechniquestofindnewcustomersandbuildlong-termbusinessrelationships.Also,focusonmarketingandpricingstrategies. Conductphoneprospecting,salespresentations,virtualdemonstrations,andcontractnegotiationswithminimalsupervision. Identifycustomerneedsandapplysolution-basedsellingtechniquestodemonstratethevalueof GrasLawnsserviceseffectively. Buildandnurturerelationshipswithpotentialandcurrentclients. Planyourdailyactivitiesandaimtomeetspecificperformancebenchmarkstoclosebusinessdealssuccessfully. ConsistentlyandreliablylogactivitiesintheCRM. Workeffectivelyinafast-pacedenvironmentwhilemaintainingastrongsenseofurgency. Communicateproactivelywithallclients,prospects,andcolleagues. SkillsRequired: ExtensiveexperienceintheCommercialLandscapeIndustry Proventrackrecordofsalesgoalattainmentandpipelinemanagement 3-5yearsofexperienceinB2Bsalesatmid-to-seniorlevels. Localknowledgeandcontactsinoneormoremarketsegments Proficientwithcomputerprograms,including AspireandaCRMtool Highlycompetitive,positive,andresults-driven Exceptionalmultitasker. Excellentoralandwrittencommunicationabilities,strongpresentationskills,andprofessionalexperiencewithsocialmedia. Passionate,organized,andresourcefulindividualwithoutstandinglisteningandinterpersonalskills. Highly organized, self-motivated, and hardworking, with effective time management capabilities. Easilyadaptabletonewsituations. Salary commensurate with experience. Youwillberesponsiblefor: TheBusinessDeveloperoverseesthesalespipelinefromtheprospectingstagetoclosingandisaccountablefortheentiresalescycle,includingsnowsalesincertainregions.Additionally,the BusinessDeveloperworksincollaborationwithpartnersacrossoperations,finance,marketing,andotherdepartmentstoeffectivelyrespondtobidsandachievesalesgoals. Salary commensurate with experience.

Mount Laurel, New Jersey, United States of America **Hours:** 40 **Pay Details:** $95,264 - $155,376 USD TD is committed to providing fair and equitable compensation opportunities to all colleagues. Growth opportunities and skill development are defining features of the colleague experience at TD. Our compensation policies and practices have been designed to allow colleagues to progress through the salary range over time as they progress in their role. The base pay actually offered may vary based upon the candidate's skills and experience, job-related knowledge, geographic location, and other specific business and organizational needs. As a candidate, you are encouraged to ask compensation related questions and have an open dialogue with your recruiter who can provide you more specific details for this role. **Line of Business:** Analytics, Insights, & Artificial Intelligence **Job Description:** **Job Summary:** The Business Insights Specialist is responsible for conducting analyses on curated and/or aggregated DataMart's in conjunction with deep business subject matter expertise, to generate relevant analytical insights for business issues and identify opportunities to drive business growth and value. This role works in partnership with business leaders to present or generate appropriate insights including the delivery of supporting collateral and/or presentations. **Depth & Scope:** + Works autonomously and accountable for acting as a lead within a specialized business management function and may provide work direction to others + Provides seasoned specialized knowledge, advice and/or guidance to various stakeholders and team members + Scope of role may have enterprise impact + Focuses on short to medium - term issues (e.g. 6-12 months) + Undertakes and completes a variety of complex projects and initiatives requiring specialist knowledge and/or the integration of cross functional processes within own area of expertise + Oversees and/or independently performs tasks from end-to-end + May interact with any hierarchy level up to executive leaders and external vendors **Education & Experience:** + Undergraduate degree or advanced technical degree preferred (e.g., math, physics, engineering, finance or computer science) Graduate's degree preferred with either progressive project work experience, or; + 5+ year of relevant experience; higher degree education and research tenure can be counted **Customer Accountabilities:** + Leads on the interpretation of complex business issues, generates multifaceted insights and identifies opportunities to help drive business growth or address business/enterprise needs + Presents and communicates generated insights and recommended business actions to stakeholders/business leaders in an easily digestible manner, leveraging tools/techniques/methods to produce a variety of visualizations/presentations that fit the audience + Acts as the primary interface with business to bridge and translate business requirements to analytics and reporting needs for a given domain/business + Applies collaborative and strong stakeholder management approach to constructively influence and persuade stakeholders and partners where appropriate + Serves as an authority on a given business domain and provides business expertise to place context around analytics discovery and inform recommendations + Escalates data/process related problems and communicates to relevant teams in a timely manner and makes recommendations for resolution + Provides day-to-day support and delivery of analytics **Shareholder Accountabilities:** + Represents functional area as a business insights & analytics specialized expert + Synthesizes complex and vast amount of information and translates into actionable insights and strategy + Builds business requirements and facilitates project execution to develop insights + Collaborates with partners on business challenges and delivers fact-based analytical advice that aligns to strategy and drives shareholder value + Identifies opportunities for business growth within a specific business or function by identifying potential use cases and value drivers + Utilizes both quantitative and qualitative methodologies to interpret and present data effectively and clearly + Works directly with the business teams to gather the demand for analytics and work with the analytics hub to fulfill the analytics demand + Provides business explanation for anomalies/outliers identified during analysis + Works with business functions and analytics teams to transition business requirements to analytics requirements + Trains business users on how to integrate analytics into decisions + Leverages knowledge of data capabilities to build and deliver insights + Develops analysis to corroborate initial proof of concept + Executes on data requests accurately and within a timely manner + Identifies and investigates data/analytics related issues + Ensures business operations are in compliance with applicable internal and external requirements (e.g. financial controls, segregation of duties, transaction approvals and physical control of assets) + Leads/facilitates and/or implements action/remediation plans to address performance/risk/governance issues + Actively manages relationships within and across various business lines, corporate and/or control functions and ensures alignment with enterprise and/or regulatory requirements + Keeps abreast of emerging issues, trends, and evolving regulatory requirements and assesses potential impacts + Maintains a culture of risk management and control, supported by effective processes in alignment with risk appetite **Employee/Team Accountabilities:** + Participates fully as a member of the team, supports a positive work environment that promotes service to the business, quality, innovation and teamwork and ensures timely communication of issues/points of interest + Provides thought leadership and/or industry knowledge for own area of expertise in own area and participates in knowledge transfer within the team and business unit + Keeps current on emerging trends/developments and grows knowledge of the business, related tools and techniques + Participates in personal performance management and development activities, including cross training within own team + Keeps others informed and up to date about the status/progress of projects and/or all relevant or useful information related to day-to-day activities + Contributes to team development of skills and capabilities through mentorship of others, by sharing knowledge and experiences and leveraging best practices + Leads, motivates and develops relationships with internal and external business partners/stakeholders to develop productive working relationships + Contributes to a fair, positive and equitable environment that supports a diverse workforce + Acts as a brand ambassador for your business area/function and the bank, both internally and/or externally **Physical Requirements:** Never: 0%; Occasional: 1-33%; Frequent: 34-66%; Continuous: 67-100% + Domestic Travel - Occasional + International Travel - Never + Performing sedentary work - Continuous + Performing multiple tasks - Continuous + Operating standard office equipment - Continuous + Responding quickly to sounds - Occasional + Sitting - Continuous + Standing - Occasional + Walking - Occasional + Moving safely in confined spaces - Occasional + Lifting/Carrying (under 25 lbs.) - Occasional + Lifting/Carrying (over 25 lbs.) - Never + Squatting - Occasional + Bending - Occasional + Kneeling - Never + Crawling - Never + Climbing - Never + Reaching overhead - Never + Reaching forward - Occasional + Pushing - Never + Pulling - Never + Twisting - Never + Concentrating for long periods of time - Continuous + Applying common sense to deal with problems involving standardized situations - Continuous + Reading, writing and comprehending instructions - Continuous + Adding, subtracting, multiplying and dividing - Continuous The above statements are intended to describe the general nature and level of work being performed by people assigned to this job. They are not intended to be an exhaustive list of all responsibilities, duties and skills required. The listed or specified responsibilities & duties are considered essential functions for ADA purposes. **Who We Are:** TD is one of the world's leading global financial institutions and is the fifth largest bank in North America by branches/stores. Every day, we deliver legendary customer experiences to over 27 million households and businesses in Canada, the United States and around the world. More than 95,000 TD colleagues bring their skills, talent, and creativity to the Bank, those we serve, and the economies we support. We are guided by our vision to Be the Better Bank and our purpose to enrich the lives of our customers, communities and colleagues. TD is deeply committed to being a leader in customer experience, that is why we believe that all colleagues, no matter where they work, are customer facing. As we build our business and deliver on our strategy, we are innovating to enhance the customer experience and build capabilities to shape the future of banking. Whether you've got years of banking experience or are just starting your career in financial services, we can help you realize your potential. Through regular leadership and development conversations to mentorship and training programs, we're here to support you towards your goals. As an organization, we keep growing - and so will you. **Our Total Rewards Package** Our Total Rewards package reflects the investments we make in our colleagues to help them and their families achieve their financial, physical and mental well-being goals. Total Rewards at TD includes base salary and variable compensation/incentive awards (e.g., eligibility for cash and/or equity incentive awards, generally through participation in an incentive plan) and several other key plans such as health and well-being benefits, savings and retirement programs, paid time off (including Vacation PTO, Flex PTO, and Holiday PTO), banking benefits and discounts, career development, and reward and recognition. Learn more (*************************************** **Additional Information:** We're delighted that you're considering building a career with TD. Through regular development conversations, training programs, and a competitive benefits plan, we're committed to providing the support our colleagues need to thrive both at work and at home. **Colleague Development** If you're interested in a specific career path or are looking to build certain skills, we want to help you succeed. You'll have regular career, development, and performance conversations with your manager, as well as access to an online learning platform and a variety of mentoring programs to help you unlock future opportunities. Whether you have a passion for helping customers and want to expand your experience, or you want to coach and inspire your colleagues, there are many different career paths within our organization at TD - and we're committed to helping you identify opportunities that support your goals. **Training & Onboarding** We will provide training and onboarding sessions to ensure that you've got everything you need to succeed in your new role. **Interview Process** We'll reach out to candidates of interest to schedule an interview. We do our best to communicate outcomes to all applicants by email or phone call. **Accommodation** TD Bank is an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, age, disability, status as a protected veteran or any other characteristic protected under applicable federal, state, or local law. If you are an applicant with a disability and need accommodations to complete the application process, please email TD Bank US Workplace Accommodations Program at *************** . Include your full name, best way to reach you and the accommodation needed to assist you with the applicant process. Federal law prohibits job discrimination based on race, color, sex, sexual orientation, gender identity, national origin, religion, age, equal pay, disability and genetic information.

**What Product Systems Analysis contributes to Cardinal Health** Commercial Technologies manages the enterprise's portfolio of commercial technologies to maximize the business value of the technologies and enhance the customer experience. This function creates strategies for the portfolio and innovative solutions based on relationships with business leaders, develops back-end solutions and capabilities, and improves the front-end experience. Product System Analysis serves as a liaison between the business and IT to align product strategies and capabilities, also providing technical business specifications to IT. This job family identifies and analyzes product needs, defines requirements, objectives, and participates in the solutions making process. This job family optimize business processes by leveraging the functionality of the technology and product solution. **Job Summary** The team manages build and re-shaping of business process, procedures and accountability standards for sales enablement tools, specifically Salesforce.com and other associated technologies to maximize the business value of the technologies and enhance the user experience. This function creates strategies for the portfolio and innovative solutions based on relationships with business leaders, develops back-end solutions and capabilities, and improves the front-end experience. This role serves as a liaison between the business and IT to align product strategies and capabilities, also providing technical business specifications to IT. This job family identifies and analyzes product needs, defines requirements, objectives, and participates in the solutions making process. This job family optimize business processes by leveraging the functionality of the technology and product solution. **Responsibilities** + Functional requirements development and ownership + Work with stakeholders to understand business requirements, map key processes, understand pain points + Assess and improve upon potential business processes that need review to more efficiently migrate to Salesforce.com + Work closely with IT team to act as the voice of the customer and provide feedback on requirements and functionality + Support the business by applying cross functional subject matter expertise of business processes, systems, and integration to facilitate continuous improvement and innovation + Coordinate with the Salesforce admin team to design the functionality in SFDC + UAT testing management and hypercare support + Work closely with development team and core project team to produce product documentation including user guides, test scripts, and internal/external materials + Ability to describe complex concepts with the appropriate amount of detail based on audience + Support the field in answering questions. Provide key details to learning business partner for training materials related to functionality + User adoption management + Develop strategies and plans to drive end user adoption and optimization + Manage KPI and tools supporting change management and user adoption, providing a clear picture to stakeholders on change process and continued focal areas that may need additional support + Ability to describe complex concepts with the appropriate amount of detail based on audience + Training support + Capturing key details of the process and work with training to incorporate into user guides that support the end user experience and training strategy + Training change network to become subject matter experts and provide support to them as they work to train the business end users **Qualifications** + Bachelor's degree in related field, or equivalent work experience, preferred + 5+ years of general business experience, preferred + 2+ years experience working within Salesforce.com, preferred + Salesforce Administrator or other relevant certification, preferred + Experience with Salesforce.com implementation, configuration and/or optimization, preferred + Ability to align CRM functionality with business goals + Experience contributing to long-term strategy and execution + Ability to work cross-functionally to understand and improve business processes and determine the functional requirements + Project management experience (formal or informal) + KPI tracking and reporting for adoption and optimization + Ability to influence and negotiate across teams + Strong communication and presentation skills + Problem solving and process identification skills, preferred + Ability to travel up to 25% **What is expected of you and others at this level** + Applies comprehensive knowledge and a thorough understanding of concepts, principles, and technical capabilities to perform varied tasks and projects + May contribute to the development of policies and procedures + Works on complex projects of large scope + Develops technical solutions to a wide range of difficult problems. Solutions are innovative and consistent with organization objectives + Completes work independently receives general guidance on new projects + Work reviewed for purpose of meeting objectives + May act as a mentor to less experienced colleagues **Anticipated salary range:** $80,900 - $115,500 **Bonus eligible:** No **Benefits:** Cardinal Health offers a wide variety of benefits and programs to support health and well-being. + Medical, dental and vision coverage + Paid time off plan + Health savings account (HSA) + 401k savings plan + Access to wages before pay day with my FlexPay + Flexible spending accounts (FSAs) + Short- and long-term disability coverage + Work-Life resources + Paid parental leave + Healthy lifestyle programs **Application window anticipated to close:** 02/13/2026 *if interested in opportunity, please submit application as soon as possible. The salary range listed is an estimate. Pay at Cardinal Health is determined by multiple factors including, but not limited to, a candidate's geographical location, relevant education, experience and skills and an evaluation of internal pay equity. \#LI-TF1 _Candidates who are back-to-work, people with disabilities, without a college degree, and Veterans are encouraged to apply._ _Cardinal Health supports an inclusive workplace that values diversity of thought, experience and background. We celebrate the power of our differences to create better solutions for our customers by ensuring employees can be their authentic selves each day. Cardinal Health is an Equal_ _Opportunity/Affirmative_ _Action employer. All qualified applicants will receive consideration for employment without regard to race, religion, color, national origin, ancestry, age, physical or mental disability, sex, sexual orientation, gender identity/expression, pregnancy, veteran status, marital status, creed, status with regard to public assistance, genetic status or any other status protected by federal, state or local law._ _To read and review this privacy notice click_ here (***************************************************************************************************************************

We are a business development and sales company that executes promotional campaigns to drive sales on behalf of our brand partners. Our partners rely on us to increase revenue, generate positive experiences, and raise customer satisfaction ratings. The primary responsibility of the Business Development Associate is to create business and sales opportunities through direct-to-consumer campaigns. They will actively engage and deliver compelling product presentations in an effort to increase revenue and generate sales. Additionally, as the Business Development Associate, you will have the opportunity to take on leadership and managerial responsibilities upon successfully achieving KPIs set by senior management. If you're a passionate self-starter with an interest in business development, growth, and client relations, we look forward to hearing from you! What You'll Do as a Business Development Associate: Prospect potential customers/business opportunities by vetting warm leads Build and maintain relationships with customers, stakeholders, clients, and fellow staff Work closely with the sales and customer service teams to maintain KPIs at high levels Identify areas of improvement and communicate feedback professionally and effectively Monitor sales and customer service pipelines, track progress, and hold regular meetings with appropriate staff Examine profit and loss statements to ensure company funds are utilized appropriately Convert sales leads into valuable long-term customers by utilizing stellar customer service What We're Looking For in a Business Development Associate: A bachelor's degree or equivalent, preferred 1+ years of experience in business development and/or management, preferred Ambitious self-starters with a passion for client relations and business development Critical thinking skills, the ability to come up with creative solutions on your feet A team player who's able to communicate effectively with fellow staff and customers Familiarity with sales, lead generation, customer service, or business development practices is a plus Growth-oriented individuals looking to grow with a company long-term Why Join Us? Travel opportunities- all transportation & accommodation expenses covered! Internal growth opportunities- we only promote from within our company! Comprehensive business development guidance & mentorship Commission bonuses are available with uncapped earning potential Competitive weekly pay

Business Development Executive GBS LE: About this role: Our Business Development teams play a critical role in expanding Gartner's presence across the global market. Gartner Business Development Executives strategically acquire new clients by cultivating trust-based relationships with C-level executives to understand their mission critical priorities and uncover opportunities to deliver client-value through the lens of the industry in which they operate. Gartner Business Developers drive the full sales cycle, from identifying prospects to closure and transition of new accounts to the account management team. Our Business Development teams are relentless about building trust-based, value add relationships with clients, delivering long-term client value, and building their book of business over time. While driven for results, they are also highly collaborative with account management teams in handing off business and ensuring an exceptional client experience. Business Development Executives will be given a territory of Large-Enterprise prospects, which may be completely new prospects with no existing spend or could be clients within other Gartner areas. Clients of the Large-Enterprise sales teams +$1bil in annual revenue. What you will do: Seek out and drive new business opportunities with new-to-Gartner organizations across your territory, from initial client outreach to close, targeting Large Enterprise organizations. Convert viable prospects into active Gartner clients, owning the full sales conversation and negotiation, through to the transition of new clients to the account management team. Continually build a pipeline of high-quality opportunities to deliver against your sales metrics ensuring KPI's are met. Quota responsibility for your assigned territory. Manage complex high-revenue sales across matrix and diverse business environments. Own forecasting and account planning on a monthly/quarterly/annual basis. What you will need: 5+ years' B2B sales experience, preferably within a complex, intangible sales environments. Business development or new-client acquisition experience in a selling role highly desired. Experience selling to and/or influencing C-level executives. Proven track record meeting and exceeding sales targets. Proven ability to precisely manage and forecast a complex sale process. Willingness to conduct travel as needed. Progression within Business Development Executive Roles: Gartner offers a lifetime of opportunities driven by our growth. How far you go is driven by your passion and performance. Gartner has a promote from within culture and limitless opportunities for progression. Gartner leaders embrace this culture and are focused on helping associates achieve success in current role, as well as coaching associates to the next role or path, whether it be more senior BD levels, account management paths, or sales leadership. Typical internal promotions include: Business Development Director Team Lead Sales Manager Most of our Sales Managers and Team Leads are hired internally as part of our progression path. What you will get: Competitive salary, generous paid time off policy, charity match program, and more! Collaborative, team-oriented culture that embraces diversity Professional development and unlimited growth opportunities Our awards and accolades: Fortune World's Most Admired Companies 2016, 2017, 2018, 2019, 2020, 2021, 2022 & 2023. Forbes America's Best Employers 2018, 2019 & 2022. Forbes America's Best Employers for Diversity, 2020, 2021 & 2022. Forbes America's Best Employers for Women 2022. Human Rights Campaign Corporate Equality Index Best Places to Work for LBGTQ Equality 2018, 2019, 2020, 2021 & 2022. Disability Equality Index Award for Best Places to Work for Disability Inclusion 2021 & 2022. Newsweek America's Most Responsible Companies 2022 & 2023. #LI-TK4 #LI-Remote Who are we? At Gartner, Inc. (NYSE:IT), we guide the leaders who shape the world. Our mission relies on expert analysis and bold ideas to deliver actionable, objective business and technology insights, helping enterprise leaders and their teams succeed with their mission-critical priorities. Since our founding in 1979, we've grown to 21,000 associates globally who support ~14,000 client enterprises in ~90 countries and territories. We do important, interesting and substantive work that matters. That's why we hire associates with the intellectual curiosity, energy and drive to want to make a difference. The bar is unapologetically high. So is the impact you can have here. What makes Gartner a great place to work? Our vast, virtually untapped market potential offers limitless opportunities - opportunities that may not even exist right now - for you to grow professionally and flourish personally. How far you go is driven by your passion and performance. We hire remarkable people who collaborate and win as a team. Together, our singular, unifying goal is to deliver results for our clients. Our teams are inclusive and composed of individuals from different geographies, cultures, religions, ethnicities, races, genders, sexual orientations, abilities and generations. We invest in great leaders who bring out the best in you and the company, enabling us to multiply our impact and results. This is why, year after year, we are recognized worldwide as a great place to work. What do we offer? Gartner offers world-class benefits, highly competitive compensation and disproportionate rewards for top performers. In our hybrid work environment, we provide the flexibility and support for you to thrive - working virtually when it's productive to do so and getting together with colleagues in a vibrant community that is purposeful, engaging and inspiring. Ready to grow your career with Gartner? Join us. Gartner believes in fair and equitable pay. A reasonable estimate of the base salary range for this role is 98,000 USD - 143,000 USD. Please note that actual salaries may vary within the range, or be above or below the range, based on factors including, but not limited to, education, training, experience, professional achievement, business need, and location. In addition to base salary, employees will participate in either an annual bonus plan based on company and individual performance, or a role-based, uncapped sales incentive plan. Our talent acquisition team will provide the specific opportunity on our bonus or incentive programs to eligible candidates. We also offer market leading benefit programs including generous PTO, a 401k match up to $7,200 per year, the opportunity to purchase company stock at a discount, and more. The policy of Gartner is to provide equal employment opportunities to all applicants and employees without regard to race, color, creed, religion, sex, sexual orientation, gender identity, marital status, citizenship status, age, national origin, ancestry, disability, veteran status, or any other legally protected status and to seek to advance the principles of equal employment opportunity. Gartner is committed to being an Equal Opportunity Employer and offers opportunities to all job seekers, including job seekers with disabilities. If you are a qualified individual with a disability or a disabled veteran, you may request a reasonable accommodation if you are unable or limited in your ability to use or access the Company's career webpage as a result of your disability. You may request reasonable accommodations by calling Human Resources at or by sending an email . Job Requisition ID:85408 By submitting your information and application, you confirm that you have read and agree to the country or regional recruitment notice linked below applicable to your place of residence. Gartner Applicant Privacy Link: applicant-privacy-policy For efficient navigation through the application, please only use the back button within the application, not the back arrow within your browser.

Hours: 40 Pay Details: $92,220 - $149,310 USD TD is committed to providing fair and equitable compensation opportunities to all colleagues. Growth opportunities and skill development are defining features of the colleague experience at TD. Our compensation policies and practices have been designed to allow colleagues to progress through the salary range over time as they progress in their role. The base pay actually offered may vary based upon the candidate's skills and experience, job-related knowledge, geographic location, and other specific business and organizational needs. As a candidate, you are encouraged to ask compensation related questions and have an open dialogue with your recruiter who can provide you more specific details for this role. Line of Business: Analytics, Insights, & Artificial Intelligence : The Business Insights Specialist is responsible for conducting analyses on curated and/or aggregated DataMart's in conjunction with deep business subject matter expertise, to generate relevant analytical insights for business issues and identify opportunities to drive business growth and value. This role works in partnership with business leaders to present or generate appropriate insights including the delivery of supporting collateral and/or presentations. Job Description Depth & Scope: Works autonomously and accountable for acting as a lead within a specialized business management function and may provide work direction to others Provides seasoned specialized knowledge, advice and/or guidance to various stakeholders and team members Scope of role may have enterprise impact Focuses on short to medium - term issues (e.g. 6-12 months) Undertakes and completes a variety of complex projects and initiatives requiring specialist knowledge and/or the integration of cross functional processes within own area of expertise Oversees and/or independently performs tasks from end-to-end May interact with any hierarchy level up to executive leaders and external vendors Education & Experience: Undergraduate degree or advanced technical degree preferred (e.g., math, physics, engineering, finance or computer science) Graduate's degree preferred with either progressive project work experience, or; 5+ year of relevant experience; higher degree education and research tenure can be counted Preferred Skills: Experience with PowerBI or Tableau Data Analytics & Technology Skills Ability to prioritize and work in a fast-paced environment Relevant Audit experience is a plus, but not required Customer Accountabilities: Leads on the interpretation of complex business issues, generates multifaceted insights and identifies opportunities to help drive business growth or address business/enterprise needs Presents and communicates generated insights and recommended business actions to stakeholders/business leaders in an easily digestible manner, leveraging tools/techniques/methods to produce a variety of visualizations/presentations that fit the audience Acts as the primary interface with business to bridge and translate business requirements to analytics and reporting needs for a given domain/business Applies collaborative and strong stakeholder management approach to constructively influence and persuade stakeholders and partners where appropriate Serves as an authority on a given business domain and provides business expertise to place context around analytics discovery and inform recommendations Escalates data/process related problems and communicates to relevant teams in a timely manner and makes recommendations for resolution Provides day-to-day support and delivery of analytics Shareholder Accountabilities: Represents functional area as a business insights & analytics specialized expert Synthesizes complex and vast amount of information and translates into actionable insights and strategy Builds business requirements and facilitates project execution to develop insights Collaborates with partners on business challenges and delivers fact-based analytical advice that aligns to strategy and drives shareholder value Identifies opportunities for business growth within a specific business or function by identifying potential use cases and value drivers Utilizes both quantitative and qualitative methodologies to interpret and present data effectively and clearly Works directly with the business teams to gather the demand for analytics and work with the analytics hub to fulfill the analytics demand Provides business explanation for anomalies/outliers identified during analysis Works with business functions and analytics teams to transition business requirements to analytics requirements Trains business users on how to integrate analytics into decisions Leverages knowledge of data capabilities to build and deliver insights Develops analysis to corroborate initial proof of concept Executes on data requests accurately and within a timely manner Identifies and investigates data/analytics related issues Ensures business operations are in compliance with applicable internal and external requirements (e.g. financial controls, segregation of duties, transaction approvals and physical control of assets) Leads/facilitates and/or implements action/remediation plans to address performance/risk/governance issues Actively manages relationships within and across various business lines, corporate and/or control functions and ensures alignment with enterprise and/or regulatory requirements Keeps abreast of emerging issues, trends, and evolving regulatory requirements and assesses potential impacts Maintains a culture of risk management and control, supported by effective processes in alignment with risk appetite Employee/Team Accountabilities: Participates fully as a member of the team, supports a positive work environment that promotes service to the business, quality, innovation and teamwork and ensures timely communication of issues/points of interest Provides thought leadership and/or industry knowledge for own area of expertise in own area and participates in knowledge transfer within the team and business unit Keeps current on emerging trends/developments and grows knowledge of the business, related tools and techniques Participates in personal performance management and development activities, including cross training within own team Keeps others informed and up to date about the status/progress of projects and/or all relevant or useful information related to day-to-day activities Contributes to team development of skills and capabilities through mentorship of others, by sharing knowledge and experiences and leveraging best practices Leads, motivates and develops relationships with internal and external business partners/stakeholders to develop productive working relationships Contributes to a fair, positive and equitable environment that supports a diverse workforce Acts as a brand ambassador for your business area/function and the bank, both internally and/or externally Contribute to data deliverables including Internal, Senior Management, and Audit Committee Reporting Apply automation and innovation on data platforms to support business function Design and implement complex business data information management frameworks to provide a solution that meets business requirements Understand business data and provide analysis and requirements to ensure the data design / development initiatives are in line with the planned design and standards Conduct meaningful analysis at the functional or enterprise level using results to draw conclusions, make recommendations, assess the effectiveness of programs/ policies/ practices. Implement continuous process / performance improvements where opportunities exist. #LI-AMCBCorporate #IN-AMCBCorporate Who We Are: TD is one of the world's leading global financial institutions and is the fifth largest bank in North America by branches/stores. Every day, we deliver legendary customer experiences to over 27 million households and businesses in Canada, the United States and around the world. More than 95,000 TD colleagues bring their skills, talent, and creativity to the Bank, those we serve, and the economies we support. We are guided by our vision to Be the Better Bank and our purpose to enrich the lives of our customers, communities and colleagues. TD is deeply committed to being a leader in customer experience, that is why we believe that all colleagues, no matter where they work, are customer facing. As we build our business and deliver on our strategy, we are innovating to enhance the customer experience and build capabilities to shape the future of banking. Whether you've got years of banking experience or are just starting your career in financial services, we can help you realize your potential. Through regular leadership and development conversations to mentorship and training programs, we're here to support you towards your goals. As an organization, we keep growing - and so will you. Our Total Rewards Package Our Total Rewards package reflects the investments we make in our colleagues to help them and their families achieve their financial, physical and mental well-being goals. Total Rewards at TD includes base salary and variable compensation/incentive awards (e.g., eligibility for cash and/or equity incentive awards, generally through participation in an incentive plan) and several other key plans such as health and well-being benefits, savings and retirement programs, paid time off (including Vacation PTO, Flex PTO, and Holiday PTO), banking benefits and discounts, career development, and reward and recognition. Learn more Additional Information: We're delighted that you're considering building a career with TD. Through regular development conversations, training programs, and a competitive benefits plan, we're committed to providing the support our colleagues need to thrive both at work and at home. Colleague Development If you're interested in a specific career path or are looking to build certain skills, we want to help you succeed. You'll have regular career, development, and performance conversations with your manager, as well as access to an online learning platform and a variety of mentoring programs to help you unlock future opportunities. Whether you have a passion for helping customers and want to expand your experience, or you want to coach and inspire your colleagues, there are many different career paths within our organization at TD - and we're committed to helping you identify opportunities that support your goals. Training & Onboarding We will provide training and onboarding sessions to ensure that you've got everything you need to succeed in your new role. Interview Process We'll reach out to candidates of interest to schedule an interview. We do our best to communicate outcomes to all applicants by email or phone call. Accommodation TD Bank is an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, age, disability, status as a protected veteran or any other characteristic protected under applicable federal, state, or local law. If you are an applicant with a disability and need accommodations to complete the application process, please email TD Bank US Workplace Accommodations Program at ***************. Include your full name, best way to reach you and the accommodation needed to assist you with the applicant process.

Alcott HR is seeking an experienced Outside Sales professional to join our team as a Senior Business Consultant. As a Professional Employer Organization, we offer comprehensive Human Resources support to our clients. In this role, you will spearhead the launch of our services in the Philadelphia market, serving as the primary sales representative. Your main responsibilities will include identifying potential business opportunities, fostering strong relationships throughout the area, and engaging with potential clients to understand their needs. You will work closely with business owners and key decision-makers to provide tailored HR solutions. We've got a lot to offer: Uncapped commission and unlimited territory Ability to sell any of our offerings to any industry (PEO, ASO, HRO, HR Consulting) Competitive base salary plus an industry-leading commission plan with escalating rates Remote schedule Here's what you'll do: Develop and maintain relationships with business owners and key decision makers. Leverage your professional network to generate referral business and expand Alcott HR's client base Network with business advisors to educate them on Alcott HR's offerings and benefits for their clients Prospect and network for business owners and key decision makers to explain how Alcott HR can help their company to grow Complete required sales process, paperwork and finalize new client contracts Travel throughout our open territory. No set territories with Alcott HR! Exceed sales goals determined by management, and reach your maximum earning potential You are someone who has: 2+ years of business-to-business sales experience with a focus on relationship-building Successful and stable track record of excellence Ability to aggressively prospect for new business A positive and consultative mindset when engaging with clients Exceptional verbal and written communication abilities, particularly with C-level executives Ability to work independently, as well as being a collaborative team member Expertise in consultative and solution-oriented sales techniques A driven, self-starter attitude with strong time management skills We definitely want to talk to you if you have the following: Demonstrated ability in cold calling and prospecting with a positive and persistent style Proven ability to be a "hunter gatherer" within the C-level market PEO and/or Employee Benefit sales experience We know you have your choice of roles for your next opportunity. Here's why we think you should choose Alcott HR: You'll be joining a PEO & HR company that is poised for rapid growth, taking a new and exciting service model and message to underserved markets across the US. We have a big market to go after, striving to provide the best and most unique HR service in the space, and some of the most loyal and enthusiastic clients behind us. Big Enough to Get the Job Done, Small Enough to Care. Family working environment with the ability to influence executive decision making and help steer the ship. Compensation: Base Salary of $70,000-$85,000 plus commission structure, enabling a potential total earning potential of $105,000-$185,000+ About Alcott HR At Alcott HR, we have a Passion for People and Performance™. We empower leaders to focus on their core business purposes and meaning which enables them to more quickly and efficiently grow their business. Alcott HR provides clients and business owners with customized solutions for running their business, including HR best practices, regulatory compliance, payroll, training and development, employee benefits, risk management support, workers' compensation insurance and employment related administration. We serve a diverse group of successful profit and not for profit businesses across the U.S. Get to know us by visiting ***************** Alcott HR provides equal employment opportunities (EEO) to all employees and applicants for employment without regard to race, color, religion, sex, national origin, age, disability or genetics. In addition to federal law requirements, Alcott HR complies with applicable state and local laws governing nondiscrimination in employment in every location in which the company has facilities.

Our client, a growing, privately owned, Light Industrial Staffing services, in New jersey is looking for a Business Development professional to join their team. This role will focus on bringing in new Light Industrial business in the Southern, NJ, Philly, and Northern Delaware market. Most of this position is field based and Friday's are spent in their Southern New Jersey office Responsibilities include; Prospecting new business by phone, email, social media, and in-person Meeting new clients within an assigned territory (with no internal competition) nts. Using Salesforce to document sales activity, meetings, follow ups etc. Contract negotiations. Reach agreed upon monthly sales targets. YOU might be the right person if YOU have: Previous light industrial temporary staffing sales experience or recruiting experience. Outside B2B sales experience selling into the light industrial space Strong closing abilities. Strong sense or urgency Attention to detail. Our client offers a competitive base salary, commission, car allowance, phone and benefits Master Search Solutions is a direct hire recruiting firm that specializes in the New Jersey marketplace. We have nearly 30 years of experience connecting top talent with leading businesses. We are committed to (and celebrate) diversity, equity, and inclusion.

Hours: 40 Pay Details: $95,264 - $155,376 USD TD is committed to providing fair and equitable compensation opportunities to all colleagues. Growth opportunities and skill development are defining features of the colleague experience at TD. Our compensation policies and practices have been designed to allow colleagues to progress through the salary range over time as they progress in their role. The base pay actually offered may vary based upon the candidate's skills and experience, job-related knowledge, geographic location, and other specific business and organizational needs. As a candidate, you are encouraged to ask compensation related questions and have an open dialogue with your recruiter who can provide you more specific details for this role. Line of Business: Analytics, Insights, & Artificial Intelligence Job Description: Job Summary: The Business Insights Specialist is responsible for conducting analyses on curated and/or aggregated DataMart's in conjunction with deep business subject matter expertise, to generate relevant analytical insights for business issues and identify opportunities to drive business growth and value. This role works in partnership with business leaders to present or generate appropriate insights including the delivery of supporting collateral and/or presentations. Depth & Scope: * Works autonomously and accountable for acting as a lead within a specialized business management function and may provide work direction to others * Provides seasoned specialized knowledge, advice and/or guidance to various stakeholders and team members * Scope of role may have enterprise impact * Focuses on short to medium - term issues (e.g. 6-12 months) * Undertakes and completes a variety of complex projects and initiatives requiring specialist knowledge and/or the integration of cross functional processes within own area of expertise * Oversees and/or independently performs tasks from end-to-end * May interact with any hierarchy level up to executive leaders and external vendors Education & Experience: * Undergraduate degree or advanced technical degree preferred (e.g., math, physics, engineering, finance or computer science) Graduate's degree preferred with either progressive project work experience, or; * 5+ year of relevant experience; higher degree education and research tenure can be counted Customer Accountabilities: * Leads on the interpretation of complex business issues, generates multifaceted insights and identifies opportunities to help drive business growth or address business/enterprise needs * Presents and communicates generated insights and recommended business actions to stakeholders/business leaders in an easily digestible manner, leveraging tools/techniques/methods to produce a variety of visualizations/presentations that fit the audience * Acts as the primary interface with business to bridge and translate business requirements to analytics and reporting needs for a given domain/business * Applies collaborative and strong stakeholder management approach to constructively influence and persuade stakeholders and partners where appropriate * Serves as an authority on a given business domain and provides business expertise to place context around analytics discovery and inform recommendations * Escalates data/process related problems and communicates to relevant teams in a timely manner and makes recommendations for resolution * Provides day-to-day support and delivery of analytics Shareholder Accountabilities: * Represents functional area as a business insights & analytics specialized expert * Synthesizes complex and vast amount of information and translates into actionable insights and strategy * Builds business requirements and facilitates project execution to develop insights * Collaborates with partners on business challenges and delivers fact-based analytical advice that aligns to strategy and drives shareholder value * Identifies opportunities for business growth within a specific business or function by identifying potential use cases and value drivers * Utilizes both quantitative and qualitative methodologies to interpret and present data effectively and clearly * Works directly with the business teams to gather the demand for analytics and work with the analytics hub to fulfill the analytics demand * Provides business explanation for anomalies/outliers identified during analysis * Works with business functions and analytics teams to transition business requirements to analytics requirements * Trains business users on how to integrate analytics into decisions * Leverages knowledge of data capabilities to build and deliver insights * Develops analysis to corroborate initial proof of concept * Executes on data requests accurately and within a timely manner * Identifies and investigates data/analytics related issues * Ensures business operations are in compliance with applicable internal and external requirements (e.g. financial controls, segregation of duties, transaction approvals and physical control of assets) * Leads/facilitates and/or implements action/remediation plans to address performance/risk/governance issues * Actively manages relationships within and across various business lines, corporate and/or control functions and ensures alignment with enterprise and/or regulatory requirements * Keeps abreast of emerging issues, trends, and evolving regulatory requirements and assesses potential impacts * Maintains a culture of risk management and control, supported by effective processes in alignment with risk appetite Employee/Team Accountabilities: * Participates fully as a member of the team, supports a positive work environment that promotes service to the business, quality, innovation and teamwork and ensures timely communication of issues/points of interest * Provides thought leadership and/or industry knowledge for own area of expertise in own area and participates in knowledge transfer within the team and business unit * Keeps current on emerging trends/developments and grows knowledge of the business, related tools and techniques * Participates in personal performance management and development activities, including cross training within own team * Keeps others informed and up to date about the status/progress of projects and/or all relevant or useful information related to day-to-day activities * Contributes to team development of skills and capabilities through mentorship of others, by sharing knowledge and experiences and leveraging best practices * Leads, motivates and develops relationships with internal and external business partners/stakeholders to develop productive working relationships * Contributes to a fair, positive and equitable environment that supports a diverse workforce * Acts as a brand ambassador for your business area/function and the bank, both internally and/or externally Physical Requirements: Never: 0%; Occasional: 1-33%; Frequent: 34-66%; Continuous: 67-100% * Domestic Travel - Occasional * International Travel - Never * Performing sedentary work - Continuous * Performing multiple tasks - Continuous * Operating standard office equipment - Continuous * Responding quickly to sounds - Occasional * Sitting - Continuous * Standing - Occasional * Walking - Occasional * Moving safely in confined spaces - Occasional * Lifting/Carrying (under 25 lbs.) - Occasional * Lifting/Carrying (over 25 lbs.) - Never * Squatting - Occasional * Bending - Occasional * Kneeling - Never * Crawling - Never * Climbing - Never * Reaching overhead - Never * Reaching forward - Occasional * Pushing - Never * Pulling - Never * Twisting - Never * Concentrating for long periods of time - Continuous * Applying common sense to deal with problems involving standardized situations - Continuous * Reading, writing and comprehending instructions - Continuous * Adding, subtracting, multiplying and dividing - Continuous The above statements are intended to describe the general nature and level of work being performed by people assigned to this job. They are not intended to be an exhaustive list of all responsibilities, duties and skills required. The listed or specified responsibilities & duties are considered essential functions for ADA purposes. Who We Are: TD is one of the world's leading global financial institutions and is the fifth largest bank in North America by branches/stores. Every day, we deliver legendary customer experiences to over 27 million households and businesses in Canada, the United States and around the world. More than 95,000 TD colleagues bring their skills, talent, and creativity to the Bank, those we serve, and the economies we support. We are guided by our vision to Be the Better Bank and our purpose to enrich the lives of our customers, communities and colleagues. TD is deeply committed to being a leader in customer experience, that is why we believe that all colleagues, no matter where they work, are customer facing. As we build our business and deliver on our strategy, we are innovating to enhance the customer experience and build capabilities to shape the future of banking. Whether you've got years of banking experience or are just starting your career in financial services, we can help you realize your potential. Through regular leadership and development conversations to mentorship and training programs, we're here to support you towards your goals. As an organization, we keep growing - and so will you. Our Total Rewards Package Our Total Rewards package reflects the investments we make in our colleagues to help them and their families achieve their financial, physical and mental well-being goals. Total Rewards at TD includes base salary and variable compensation/incentive awards (e.g., eligibility for cash and/or equity incentive awards, generally through participation in an incentive plan) and several other key plans such as health and well-being benefits, savings and retirement programs, paid time off (including Vacation PTO, Flex PTO, and Holiday PTO), banking benefits and discounts, career development, and reward and recognition. Learn more Additional Information: We're delighted that you're considering building a career with TD. Through regular development conversations, training programs, and a competitive benefits plan, we're committed to providing the support our colleagues need to thrive both at work and at home. Colleague Development If you're interested in a specific career path or are looking to build certain skills, we want to help you succeed. You'll have regular career, development, and performance conversations with your manager, as well as access to an online learning platform and a variety of mentoring programs to help you unlock future opportunities. Whether you have a passion for helping customers and want to expand your experience, or you want to coach and inspire your colleagues, there are many different career paths within our organization at TD - and we're committed to helping you identify opportunities that support your goals. Training & Onboarding We will provide training and onboarding sessions to ensure that you've got everything you need to succeed in your new role. Interview Process We'll reach out to candidates of interest to schedule an interview. We do our best to communicate outcomes to all applicants by email or phone call. Accommodation TD Bank is an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, age, disability, status as a protected veteran or any other characteristic protected under applicable federal, state, or local law. If you are an applicant with a disability and need accommodations to complete the application process, please email TD Bank US Workplace Accommodations Program at ***************. Include your full name, best way to reach you and the accommodation needed to assist you with the applicant process.